You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07898
Secondary Accession Numbers
  • 13609
Name Protocadherin beta-8
Synonyms
  1. PCDH-beta-8
  2. Protocadherin-3I
Gene Name PCDHB8
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31
SNPs PCDHB8
Gene Sequence
>2406 bp
ATGGAGGCCAGCGGGAAGCTCATTTGCAGACAAAGGCAAGTCCTTTTTTCCTTTCTCCTT
TTGGGCTTATCTCTGGCGGGCGCGGCGGAACCTAGAAGCTATTCTGTGGTGGAGGAAACT
GAGGGCAGCTCCTTTGTCACCAATTTAGCAAAGGACCTGGGTCTGGAGCAGAGGGAATTC
TCCAGGCGGGGGGTTAGGGTTGTTTCCAGAGGGAACAAACTACATTTGCAGCTCAATCAG
GAGACCGCGGATTTGTTGCTAAATGAGAAATTGGACCGTGAGGATCTGTGCGGTCACACA
GAGCCCTGTGTGCTACGTTTCCAAGTGTTGCTAGAGAGTCCCTTCGAGTTTTTTCAAGCT
GAGCTGCAAGTAATAGACATAAACGACCACTCTCCAGTATTTCTGGACAAACAAATGTTG
GTGAAAGTATCAGAGAGCAGTCCTCCTGGGACTGCGTTTCCTCTGAAGAATGCTGAAGAC
TTAGATATAGGCCAAAACAATATTGAGAACTATATAATCAGCCCCAACTCCTATTTTCGG
GTCCTCACCCGCAAACGCAGTGATGGCAGGAAATACCCAGAGCTGGTGCTGGACAACGCG
CTGGACCGAGAGGAAGAAGCTGAGCTCAGGTTAACACTCACAGCACTGGATGGTGGCTCT
CCGCCCAGATCTGGCACTGCTCAGGTCTACATTGAAGTTGTCGATGTCAATGATAATGCC
CCTGAATTTCAGCAGCCTTTCTATAGGGTGCAGATCTCTGAGGACAGTCCAATAAGCTTC
CTGGTTGTGAAGGTCTCTGCCACGGATGTAGACACAGGAGTCAACGGAGAGATTTCCTAT
TCACTTTTCCAAGCTTCAGATGAGATAAGCAAAACTTTTAAGGTCGATTTCTTGACAGGA
GAAATTCGACTAAAGAAACAACTTGATTTCGAAAAATTTCAGTCCTATGAAGTCAATATC
GAGGCGAGAGATGCTGGAGGCTTTTCTGGAAAATGCACCGTTCTGATTCAAGTGATAGAT
GTGAACGACCATGCCCCAGAAGTTACCATGTCTGCATTTACCAGCCCAATACCTGAGAAT
GCGCCTGAAACTGTGGTTGCACTTTTCAGTGTTTCAGACCTTGATTCAGGAGAAAATGGG
AAAATAAGTTGCTCCATTCAGGAGGATCTACCCTTCCTCCTGAAATCTTCTGTGGGGAAC
TTTTACACCCTACTAACAGAGACACCACTAGACAGAGAAAGCAGAGCCGAGTACAACGTC
ACTATCACCGTCACTGACTTAGGGACACCCAGGCTGACAACACATCTCAATATGACCGTG
CTGGTGTCGGACGTCAATGACAACGCCCCCGCCTTCACCCAAACCTCCTACACCCTGTTC
GTCCGCGAGAACAACAGCCCCGCCCTGCACATCGGCAGCGTCAGCGCCACAGACAGAGAC
TCGGGCACCAACGCCCAGGTCACCTACTCGCTGCTGCCGCCCCAGGATCCGCACCTGCCC
CTCGCCTCCCTGGTCTCCATCAACACAGACAACGGCCACCTGTTCGCCCTCAGGTCGCTG
GACTACGAGGCCCTGCAGGCGTTCGAGTTCCGGGTGGGCGCTTCAGACCGCGGCTCCCCG
GCTTTGAGCAGCGAGGCGCTGGTGCGCGTGCTGGTGCTGGACGCCAACGACAACTCGCCC
TTCGTGCTGTACCCGCTGCAGAATGGCTCCGCGCCCTGCACCGAGCTGGTGCCCCGGGCG
GCCGAGCCGGGCTACCTGGTGACCAAGGTGGTGGCGGTGGACGGCGACTCGGGCCAGAAC
GCCTGGCTGTCGTACCAGCTGCTCAAGGCCACGGAGCCCGGGCTGTTCGGTGTGTGGGCG
CACAATGGCGAGGTGCGCACCGCCAGGCTGCTGAGCGAGCGCGACGCGGCCAAGCAGAGG
CTGGTGGTGCTGGTCAAGGACAATGGCGAGCCTCCGTGCTCGGCCACCGCCACGCTGCAC
TTGCTCCTGGTGGACGGCTTCTCCCAGCCCTACCTGCCGCTTCCGGAGGCTGCCCCAGCC
CAGGGCCAGGCCGACTCTCTCACCGTCTACCTGGTGGTGGCGTTGGCCTCGGTGTCTTCG
CTCTTCCTCTTCTCGGTGCTCCTGTTCGTGGCGGTGCTGCTGTGTAGGAGGAGCAGGGCG
GCCTCGGTGGGTCGCTGCTCAGTGCCTGAGGGCCCCTTTCCAGGGCATCTGGTGGACGTG
AGGGGCACCGGGAGCCTGTCTCAGAACTATCAGTACGAGGTGTGCCTGGCAGGAGGCTCA
GGGACGAATGAGTTCCAGTTCCTGAAACCAGTATTACCTAATATTCAGGGCCATTCTTTT
GGGCCAGAAATGGAACAAAACTCTAACTTTAGGAATGGCTTTGGTTTCAGCCTTCAGTTA
AAGTAA
Protein Properties
Number of Residues 801
Molecular Weight 87637.9
Theoretical pI 4.5
Pfam Domain Function
Signals
  • 1-28
Transmembrane Regions
  • 692-710
Protein Sequence
>Protocadherin beta-8
MEASGKLICRQRQVLFSFLLLGLSLAGAAEPRSYSVVEETEGSSFVTNLAKDLGLEQREF
SRRGVRVVSRGNKLHLQLNQETADLLLNEKLDREDLCGHTEPCVLRFQVLLESPFEFFQA
ELQVIDINDHSPVFLDKQMLVKVSESSPPGTAFPLKNAEDLDIGQNNIENYIISPNSYFR
VLTRKRSDGRKYPELVLDKALDREEEAELRLTLTALDGGSPPRSGTAQVYIEVVDVNDNA
PEFEQPFYRVQISEDSPISFLVVKVSATDVDTGVNGEISYSLFQASDEISKTFKVDFLTG
EIRLKKQLDFEKFQSYEVNIEARDAGGFSGKCTVLIQVIDVNDHAPEVTMSAFTSPIPEN
APETVVALFSVSDLDSGENGKISCSIQEDLPFLLKSSVGNFYTLLTETPLDRESRAEYNV
TITVTDLGTPRLTTHLNMTVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRD
SGTNAQVTYSLLPPQDPHLPLASLVSINTDNGHLFALRSLDYEALQAFEFRVGASDRGSP
ALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQN
AWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKQRLVVLVKDNGEPPCSATATLH
LLLVDGFSQPYLPLPEAAPAQGQADSLTVYLVVALASVSSLFLFSVLLFVAVLLCRRSRA
ASVGRCSVPEGPFPGHLVDVRGTGSLSQNYQYEVCLAGGSGTNEFQFLKPVLPNIQGHSF
GPEMEQNSNFRNGFGFSLQLK
GenBank ID Protein 11142063
UniProtKB/Swiss-Prot ID Q9UN66
UniProtKB/Swiss-Prot Entry Name PCDB8_HUMAN
PDB IDs Not Available
GenBank Gene ID AF152501
GeneCard ID PCDHB8
GenAtlas ID PCDHB8
HGNC ID HGNC:8693
References
General References
  1. Wu Q, Maniatis T: A striking organization of a large family of human neural cadherin-like cell adhesion genes. Cell. 1999 Jun 11;97(6):779-90. [PubMed:10380929 ]