You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07951
Secondary Accession Numbers
  • 13662
Name Serine/threonine-protein phosphatase with EF-hands 1
Synonyms
  1. PP7
  2. PPEF
  3. PPEF-1
  4. Protein phosphatase with EF calcium-binding domain
  5. Serine/threonine-protein phosphatase 7
Gene Name PPEF1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function May have a role in the recovery or adaptation response of photoreceptors. May have a role in development.
Pathways Not Available
Reactions
A phosphoprotein + Water → a protein + Phosphoric acid details
GO Classification
Biological Process
detection of stimulus involved in sensory perception
protein dephosphorylation
Function
phosphoprotein phosphatase activity
manganese ion binding
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
transition metal ion binding
phosphoric ester hydrolase activity
phosphatase activity
protein serine/threonine phosphatase activity
iron ion binding
calcium ion binding
Molecular Function
protein serine/threonine phosphatase activity
manganese ion binding
iron ion binding
calcium ion binding
Process
response to stimulus
detection of stimulus
detection of stimulus involved in sensory perception
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location X
Locus Xp22
SNPs PPEF1
Gene Sequence
>1962 bp
ATGGGATGCAGCAGTTCTTCAACGAAAACCAGGAGATCTGACACATCACTGAGAGCTGCG
TTGATCATCCAGAACTGGTACCGAGGTTACAAAGCTCGACTGAAGGCCAGACAACACTAT
GCCCTCACCATCTTCCAGTCCATCGAATATGCTGATGAACAAGGCCAAATGCAGTTATCC
ACCTTCTTTTCCTTCATGTTGGAAAACTACACACATATACATAAGGAAGAGCTAGAATTA
AGAAATCAGTCTCTTGAAAGCGAACAGGACATGAGGGATAGATGGGATTATGTGGACTCG
ATAGATGTCCCAGACTCCTATAATGGTCCTCGGCTACAATTTCCTCTCACTTGTACGGAT
ATTGATTTACTTCTTGAGGCCTTCAAGGAACAACAGATACTTCATGCCCATTATGTCTTA
GAGGTGCTATTTGAAACCAAGAAAGTCCTGAAGCAAATGCCGAATTTCACTCACATACAA
ACTTCTCCCTCCAAAGAGGTAACAATCTGTGGTGATTTGCATGGGAAACTGGATGATCTT
TTTTTGATCTTCTACAAGAATGGTCTCCCCTCAGAGAGGAACCCGTATGTTTTTAATGGT
GACTTTGTAGATCGAGGAAAGAATTCCATAGAGATCCTAATGATCCTGTGTGTGAGTTTT
CTTGTCTACCCCAATGACCTGCACTTGAACAGAGGGAACCACGAAGATTTTATGATGAAT
CTGAGGTATGGCTTCACGAAAGAAATTTTGCATAAATATAAGCTACATGGAAAAAGAATC
TTACAAATCTTGGAAGAATTCTATGCCTGGCTCCCAATCGGTACAATCGTTGACAATGAA
ATCCTGGTCATCCATGGTGGGATATCAGAGACCACAGACTTGAATTTACTCCACCGTGTA
GAGAGGAACAAGATGAAATCTGTGCTGATACCACCAACGGAAACAAACAGAGACCATGAC
ACTGACTCGAAGCACAATAAAGTAGGTGTGACTTTTAATGCACATGGAAGAATCAAAACA
AATGGATCTCCTACTGAACACTTAACAGAGCATGAATGGGAACAGATTATTGATATTCTG
TGGAGTGATCCCAGAGGCAAAAATGGCTGTTTTCCAAATACGTGCCGAGGAGGGGGCTGC
TATTTTGGACCAGATGTTACTTCCAAGATTCTTAATAAATACCAGTTGAAGATGCTCATC
AGGTCTCATGAATGTAAGCCCGAAGGGTATGAAATCTGTCATGATGGGAAGGTGGTGACT
ATATTTTCTGCTTCTAATTATTATGAAGAAGGCAGCAATCGAGGAGCTTACATCAAACTA
TGTTCTGGTACAACTCCTCGATTTTTCCAGTACCAAGTAACTAAAGCAACGTGCTTTCAG
CCTCTTCGCCAAAGAGTGGATACTATGGAAAACAGCGCCATCAAGATATTAAGAGAGAGA
GTGATTTCACGAAAAAGTGACCTTACTCGTGCTTTCCAACTTCAAGACCACAGAAAATCA
GGAAAACTTTCTGTGAGCCAGTGGGCTTTTTGCATGGAGAACATTTTGGGGCTGAACTTA
CCATGGAGATCCCTCAGTTCGAATCTGGTAAACATAGACCAAAATGGAAACGTTGAATAC
ATGTCCAGCTTCCAGAATATCCGCATTGAAAAACCTGTACAAGAGGCTCATTCTACTCTA
GTTGAAACTCTGTACAGATACAGATCTGACCTGGAAATCATATTTAATGCCATTGACACT
GATCACTCAGGCCTGATCTCCGTGGAAGAATTTCGTGCCATGTGGAAACTTTTTAGTTCT
CACTACAATGTTCACATTGATGATTCCCAAGTCAATAAGCTTGCCAACATAATGGACTTG
AACAAAGATGGAAGCATTGACTTTAATGAGTTTTTAAAGGCTTTCTATGTAGTGCATAGA
TATGAAGACTTGATGAAACCTGATGTCACCAACCTTGGCTAA
Protein Properties
Number of Residues 653
Molecular Weight 75791.5
Theoretical pI 6.846
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Serine/threonine-protein phosphatase with EF-hands 1
MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLS
TFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTD
IDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDL
FLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMN
LRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRV
ERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDIL
WSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVT
IFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRER
VISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEY
MSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSS
HYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYVVHRYEDLMKPDVTNLG
GenBank ID Protein 2586411
UniProtKB/Swiss-Prot ID O14829
UniProtKB/Swiss-Prot Entry Name PPE1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF023455
GeneCard ID PPEF1
GenAtlas ID PPEF1
HGNC ID HGNC:9243
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  4. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [PubMed:14759258 ]
  5. Sherman PM, Sun H, Macke JP, Williams J, Smallwood PM, Nathans J: Identification and characterization of a conserved family of protein serine/threonine phosphatases homologous to Drosophila retinal degeneration C. Proc Natl Acad Sci U S A. 1997 Oct 14;94(21):11639-44. [PubMed:9326663 ]
  6. Montini E, Rugarli EI, Van de Vosse E, Andolfi G, Mariani M, Puca AA, Consalez GG, den Dunnen JT, Ballabio A, Franco B: A novel human serine-threonine phosphatase related to the Drosophila retinal degeneration C (rdgC) gene is selectively expressed in sensory neurons of neural crest origin. Hum Mol Genet. 1997 Jul;6(7):1137-45. [PubMed:9215685 ]
  7. Huang X, Honkanen RE: Molecular cloning, expression, and characterization of a novel human serine/threonine protein phosphatase, PP7, that is homologous to Drosophila retinal degeneration C gene product (rdgC). J Biol Chem. 1998 Jan 16;273(3):1462-8. [PubMed:9430683 ]