You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07971
Secondary Accession Numbers
  • 13682
Name Rho GTPase-activating protein 32
Synonyms
  1. Brain-specific Rho GTPase-activating protein
  2. GAB-associated Cdc42/Rac GTPase-activating protein
  3. GC-GAP
  4. GTPase regulator interacting with TrkA
  5. Rho-type GTPase-activating protein 32
  6. Rho/Cdc42/Rac GTPase-activating protein RICS
  7. RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling
  8. p200RhoGAP
  9. p250GAP
Gene Name ARHGAP32
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function GTPase-activating protein (GAP) promoting GTP hydrolysis on RHOA, CDC42 and RAC1 small GTPases. May be involved in the differentiation of neuronal cells during the formation of neurite extensions. Involved in NMDA receptor activity-dependent actin reorganization in dendritic spines. May mediate cross-talks between Ras- and Rho-regulated signaling pathways in cell growth regulation. Isoform 2 has higher GAP activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
protein binding
lipid binding
phospholipid binding
phosphoinositide binding
Process
cellular process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
cell communication
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Endosome membrane
  4. Membrane
  5. Endoplasmic reticulum membrane
  6. Cell junction
  7. synapse
  8. Cell projection
  9. dendritic spine
  10. postsynaptic cell membrane
  11. postsynaptic density
  12. cell cortex
Gene Properties
Chromosome Location Chromosome:1
Locus 11q24.3
SNPs ARHGAP32
Gene Sequence
>6264 bp
ATGGAGACTGAAAGTGAGAGTAGCACTTTAGGGGATGACAGTGTCTTCTGGTTGGAGTCT
GAAGTTATAATCCAGGTGACTGACTGTGAAGAGGAAGAAAGGGAAGAGAAGTTCAGGAAG
ATGAAGTCCTCAGTACATTCTGAAGAAGATGATTTTGTTCCAGAGCTACATAGAAATGTA
CACCCTCGAGAGCGGCCTGATTGGGAAGAAACTCTTAGCGCAATGGCAAGAGGCGCAGAT
GTTCCAGAGATTCCTGGAGATCTTACTCTTAAGACGTGTGGCAGTACAGCCAGTATGAAG
GTTAAGCATGTGAAAAAGTTACCCTTCACTAAAGGTCACTTTCCGAAGATGGCTGAATGT
GCGCATTTCCATTATGAGAATGTTGAGTTCGGCAGCATACAGCTTTCACTTTCAGAAGAA
CAGAATGAAGTAATGAAAAATGGCTGTGAATCTAAAGAGCTGGTCTACCTCGTGCAGATT
GCTTGTCAGGGAAAAAGTTGGATTGTTAAAAGAAGTTATGAAGATTTTCGGGTACTTGAT
AAACATCTTCATCTGTGTATTTATGACCGAAGATTTTCCCAGCTCTCAGAACTTCCCCGT
TCTGACACCCTGAAGGACAGTCCAGAGTCGGTCACTCAGATGCTTATGGCTTACCTGTCA
CGCCTTTCAGCTATCGCTGGCAACAAGATCAACTGTGGGCCCGCCCTTACCTGGATGGAG
ATTGATAATAAGGGAAATCACCTTTTGGTTCATGAGGAGTCATCCATCAACACTCCTGCT
GTCGGTGCTGCCCATGTTATCAAGAGGTACACTGCTCGGGCCCCTGACGAACTGACCTTA
GAGGTGGGAGACATTGTTTCTGTTATTGACATGCCCCCGAAAGTGTTAAGCACATGGTGG
AGAGGCAAGCACGGATTCCAGGTGGGACTCTTCCCTGGACACTGTGTTGAGTTAATTAAC
CAAAAAGTTCCCCAGTCAGTGACCAACTCAGTGCCAAAACCAGTGTCTAAAAAGCACGGC
AAGCTCATTACGTTCTTACGAACATTCATGAAGTCTCGTCCAACAAAACAGAAGCTGAAG
CAGCGGGGAATCTTGAAAGAGAGGGTGTTTGGTTGTGACCTGGGGGAACACCTTCTAAAT
TCTGGTTTTGAAGTGCCGCAGGTTCTTCAAAGCTGCACAGCATTCATTGAGAGATATGGC
ATCGTGGATGGAATCTATCGCCTTTCTGGTGTTGCCTCCAATATCCAGAGACTACGCCAT
GAATTTGACTCTGAGCACGTCCCCGACCTGACGAAAGAACCGTATGTTCAGGACATCCAT
TCTGTGGGTTCCCTATGTAAGCTGTACTTCCGGGAACTCCCAAACCCTCTGCTTACCTAC
CAGCTGTATGAGAAATTTTCTGATGCAGTTTCAGCAGCAACAGATGAAGAAAGGCTGATA
AAAATCCACGATGTCATCCAGCAGCTCCCCCCACCACACTACAGAACACTGGAGTTCCTG
ATGAGACACTTGTCTCTTCTAGCTGACTATTGTTCCATCACAAATATGCATGCAAAAAAT
CTAGCAATTGTTTGGGCTCCAAACCTGTTAAGATCAAAACAGATAGAATCTGCCTGCTTC
AGTGGAACAGCAGCTTTCATGGAAGTGAGGATTCAGTCTGTGGTTGTTGAGTTCATCCTG
AATCACGTTGATGTGCTGTTCAGCGGCAGAATCAGCATGGCCATGCAAGAGGGGGCAGCT
TCTCTATCAAGGCCCAAGTCCCTCCTGGTATCCTCTCCATCCACCAAACTGCTGACATTG
GAAGAGGCCCAGGCACGAACACAAGCTCAGGTCAATTCTCCAATTGTGACGGAAAATAAA
TATATCGAAGTAGGAGAAGGACCTGCTGCACTTCAGGGGAAATTTCATACCATAATTGAG
TTCCCACTTGAAAGAAAGAGGCCTCAAAATAAGATGAAAAAGTCTCCTGTGGGTAGCTGG
CGTTCCTTTTTCAACTTGGGGAAATCATCATCTGTTTCTAAACGAAAGCTGCAGCGGAAT
GAGAGTGAGCCTTCAGAGATGAAAGCCATGGCTCTGAAAGGTGGCAGGGCAGAAGGAACC
CTCCGTTCAGCTAAAAGTGAGGAGTCTCTTACATCTCTCCATGCAGTTGATGGTGATTCT
AAGCTCTTCCGACCCAGAAGACCCAGATCTTCCAGTGATGCACTGTCTGCCTCTTTTAAT
GGAGAAATGCTGGGGAACCGCTGTAACTCCTATGATAATCTGCCTCATGACAATGAGAGT
GAGGAGGAAGGAGGGCTGCTTCATATCCCAGCCCTTATGTCTCCTCATTCAGCTGAGGAT
GTTGACTTGAGCCCACCAGACATTGGAGTAGCCAGCCTGGATTTTGATCCAATGTCATTT
CAATGTAGTCCTCCTAAGGCCGAATCAGAATGTCTGGAGAGTGGTGCTTCCTTTTTAGAT
TCACCAGGATACTCCAAGGATAAACCAAGTGCCAATAAAAAGGATGCAGAAACAGGTAGT
AGCCAATGTCAGACTCCAGGAAGCACAGCAAGCTCTGAACCTGTCTCTCCTCTTCAGGAG
AAACTGAGTCCATTCTTTACCCTGGACTTGAGCCCAACTGAAGATAAATCATCTAAGCCA
TCCTCCTTTACTGAAAAGGTCGTCTATGCTTTCTCTCCGAAGATAGGACGGAAATTAAGC
AAATCACCTTCTATGAGCATATCTGAGCCAATTTCAGTGACCCTACCACCACGGGTGTCA
GAAGTCATTGGTACAGTCTCAAATACCACAGCTCAGAATGCATCATCTTCAACCTGGGAC
AAATGCGTTGAAGAAAGGGATGCCACAAATAGATCCCCCACCCAGATAGTAAAGATGAAA
ACAAATGAGACAGTTGCCCAAGAAGCATATGAATCTGAAGTCCAGCCCCTGGACCAGGTG
GCTGCTGAAGAAGTAGAATTGCCAGGGAAAGAGGATCAGTCTGTCTCAAGCAGTCAGAGT
AAGGCTGTAGCTTCTGGACAGACTCAGACAGGAGCAGTTACCCATGACCCCCCTCAGGAT
TCCGTTCCTGTCAGTTCAGTCTCTCTTATCCCACCACCACCGCCTCCGAAAAATGTTGCC
CGAATGTTGGCGCTAGCATTAGCTGAGTCCGCACAGCAAGCCTCAACTCAGTCATTGAAG
AGACCAGGGACCTCTCAGGCTGGGTATACAAATTATGGAGACATAGCGGTGGCTACAACT
GAAGATAATCTGTCCAGTTCTTACTCTGCAGTTGCTCTAGATAAGGCCTATTTCCAAACC
GATCGACCAGCAGAGCAGTTCCACCTCCAGAATAATGCACCAGGAAACTGTGACCATCCT
CTACCAGAGACAACAGCTACTGGGGATCCTACCCATTCCAACACAACTGAATCTGGGGAG
CAACATCACCAAGTAGACTTAACAGGGAATCAGCCACATCAAGCATATTTATCTGGGGAC
CCAGAAAAGGCCAGAATTACTTCAGTTCCCTTAGACTCAGAGAAGTCTGATGATCATGTA
AGTTTCCCTGAAGACCAGTCTGGGAAGAACAGTATGCCAACTGTCTCCTTCTTGGATCAG
GACCAGTCTCCACCCCGTTTCTACAGTGGAGATCAGCCTCCTTCTTATCTTGGTGCAAGT
GTGGATAAACTCCATCACCCTTTAGAATTTGCAGACAAATCTCCCACACCTCCTAATTTA
CCTAGCGATAAAATCTACCCTCCTTCTGGGTCCCCCGAAGAGAATACCAGCACAGCCACC
ATGACTTACATGACAACTACTCCAGCAACAGCCCAAATGAGCACCAAGGAAGCCAGCTGG
GATGTGGCTGAACAACCCACCACTGCTGATTTTGCTGCTGCCACACTTCAGCGCACGCAC
AGAACTAATCGTCCCCTTCCCCCTCCGCCTTCCCAGAGATCTGCAGAGCAGCCACCAGTT
GTGGGGCAGGTACAAGCAGCAACCAATATAGGATTAAATAATTCCCACAAGGTTCAAGGA
GTAGTTCCAGTTCCAGAGAGGCCACCTGAACCTCGAGCCATGGATGACCCTGCGTCTGCC
TTCATCAGTGACAGTGGTGCTGCTGCTGCTCAGTGTCCCATGGCTACAGCTGTCCAGCCA
GGCCTGCCTGAGAAAGTGCGGGACGGTGCCCGGGTCCCGCTGCTGCACCTGCGCGCCGAG
TCTGTCCCTGCGCATCCCTGTGGCTTTCCTGCACCACTGCCCCCCACCAGGATGATGGAG
AGTAAGATGATTGCTGCCATACACTCCAGCAGTGCAGATGCCACCAGCAGTTCAAATTAT
CATTCCTTTGTCACTGCTTCATCCACCTCTGTGGACGATGCATTGCCTTTACCACTTCCT
GTCCCACAACCTAAGCATGCTTCTCAGAAAACAGTTTACTCCTCCTTTGCTAGGCCCGAT
GTCACCACTGAACCCTTTGGTCCAGATAACTGTTTGCATTTCAATATGACTCCAAACTGC
CAGTACCGTCCCCAGAGTGTACCTCCCCATCACAATAAATTGGAGCAGCACCAAGTGTAT
GGTGCCAGGTCAGAGCCACCAGCCTCCATGGGTCTTCGTTATAACACATATGTGGCCCCA
GGAAGAAACGCATCTGGACACCACTCCAAGCCATGCAGCCGGGTCGAGTATGTGTCTTCT
TTGAGCTCCTCTGTCAGGAATACCTGTTACCCCGAAGACATTCCACCGTACCCTACCATC
CGGAGAGTGCAGTCTCTCCATGCTCCGCCGTCTTCCATGATTCGCTCTGTTCCCATTTCA
CGGACAGAAGTTCCCCCAGATGATGAGCCAGCCTACTGCCCAAGACCTCTGTACCAATAT
AAGCCATATCAGTCCTCCCAGGCCCGCTCAGATTATCATGTCACTCAGCTTCAGCCTTAC
TTTGAGAATGGCCGGGTCCACTACAGGTATAGCCCATATTCCAGTTCTTCTAGTTCCTAT
TACAGTCCAGATGGGGCCCTGTGTGATGTGGATGCCTATGGCACAGTCCAGTTGAGACCC
CTTCACCGCCTTCCCAATCGAGACTTTGCTTTCTACAATCCTAGGCTGCAAGGAAAGAGC
TTGTACAGTTATGCTGGTTTGGCTCCACGTCCCCGGGCCAACGTGACTGGCTATTTCTCT
CCCAACGACCATAATGTAGTCAGCATGCCTCCGGCTGCTGATGTGAAGCACACCTACACC
TCATGGGATCTTGAGGACATGGAAAAATACCGCATGCAGTCCATCCGGAGAGAGAGCCGT
GCTCGGCAGAAGGTGAAAGGGCCTGTCATGTCCCAATATGATAACATGACCCCGGCGGTG
CAGGACGACTTGGGTGGGATCTATGTCATCCATCTGCGTAGTAAATCAGATCCTGGGAAA
ACTGGACTTCTCTCAGTGGCAGAAGGAAAGGAGAGCCGCCATGCAGCCAAGGCCATCAGT
CCCGAGGGAGAGGACCGCTTCTATAGGAGGCATCCCGAGGCAGAGATGGACAGAGCCCAC
CATCACGGAGGCCATGGTAGCACGCAGCCGGAGAAGCCATCCCTGCCTCAGAAGCAGAGC
AGCCTGAGGAGCAGGAAGCTTCCTGACATGGGCTGCAGTCTTCCTGAGCACAGGGCACAC
CAAGAAGCAAGCCATAGGCAGTTCTGTGAGTCAAAGAATGGGCCCCCTTATCCCCAGGGA
GCTGGCCAGTTAGATTATGGGTCCAAAGGGATTCCAGACACTTCTGAGCCAGTCAGCTAC
CACAACTCTGGAGTAAAATATGCTGCATCCGGGCAAGAATCTTTAAGACTGAACCACAAA
GAGGTAAGGCTCTCCAAAGAGATGGAGCGACCCTGGGTTAGGCAGCCTTCTGCCCCAGAG
AAACACTCCAGAGACTGCTACAAGGAGGAAGAACACCTCACTCAGTCAATCGTCCCACCC
CCTAAACCAGAGAGGAGTCATAGCCTCAAACTCCATCATACCCAGAACGTGGAGAGGGAC
CCCAGTGTGCTGTACCAGTACCAACCACACGGCAAGCGCCAGAGCAGTGTGACTGTTGTG
TCCCAGTATGATAACCTGGAAGATTACCACTCCCTGCCTCAGCACCAGCGAGGAGTCTTT
GGAGGGGGCGGCATGGGGACGTATGTGCCCCCTGGCTTTCCCCATCCACAGAGCAGGACC
TATGCTACAGCGTTGGGTCAAGGGGCCTTCCTGCCCGCAGAGTTGTCCTTGCAGCATCCT
GAAACACAGATCCATGCAGAATGA
Protein Properties
Number of Residues 2087
Molecular Weight 230527.1
Theoretical pI 6.73
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho GTPase-activating protein 32
METESESSTLGDDSVFWLESEVIIQVTDCEEEEREEKFRKMKSSVHSEEDDFVPELHRNV
HPRERPDWEETLSAMARGADVPEIPGDLTLKTCGSTASMKVKHVKKLPFTKGHFPKMAEC
AHFHYENVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLD
KHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWME
IDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTLEVGDIVSVIDMPPKVLSTWW
RGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLK
QRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRH
EFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLI
KIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACF
SGTAAFMEVRIQSVVVEFILNHVDVLFSGRISMAMQEGAASLSRPKSLLVSSPSTKLLTL
EEAQARTQAQVNSPIVTENKYIEVGEGPAALQGKFHTIIEFPLERKRPQNKMKKSPVGSW
RSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGTLRSAKSEESLTSLHAVDGDS
KLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEEGGLLHIPALMSPHSAED
VDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSPGYSKDKPSANKKDAETGS
SQCQTPGSTASSEPVSPLQEKLSPFFTLDLSPTEDKSSKPSSFTEKVVYAFSPKIGRKLS
KSPSMSISEPISVTLPPRVSEVIGTVSNTTAQNASSSTWDKCVEERDATNRSPTQIVKMK
TNETVAQEAYESEVQPLDQVAAEEVELPGKEDQSVSSSQSKAVASGQTQTGAVTHDPPQD
SVPVSSVSLIPPPPPPKNVARMLALALAESAQQASTQSLKRPGTSQAGYTNYGDIAVATT
EDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETTATGDPTHSNTTESGE
QHHQVDLTGNQPHQAYLSGDPEKARITSVPLDSEKSDDHVSFPEDQSGKNSMPTVSFLDQ
DQSPPRFYSGDQPPSYLGASVDKLHHPLEFADKSPTPPNLPSDKIYPPSGSPEENTSTAT
MTYMTTTPATAQMSTKEASWDVAEQPTTADFAAATLQRTHRTNRPLPPPPSQRSAEQPPV
VGQVQAATNIGLNNSHKVQGVVPVPERPPEPRAMDDPASAFISDSGAAAAQCPMATAVQP
GLPEKVRDGARVPLLHLRAESVPAHPCGFPAPLPPTRMMESKMIAAIHSSSADATSSSNY
HSFVTASSTSVDDALPLPLPVPQPKHASQKTVYSSFARPDVTTEPFGPDNCLHFNMTPNC
QYRPQSVPPHHNKLEQHQVYGARSEPPASMGLRYNTYVAPGRNASGHHSKPCSRVEYVSS
LSSSVRNTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRTEVPPDDEPAYCPRPLYQY
KPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPDGALCDVDAYGTVQLRP
LHRLPNRDFAFYNPRLQGKSLYSYAGLAPRPRANVTGYFSPNDHNVVSMPPAADVKHTYT
SWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGK
TGLLSVAEGKESRHAAKAISPEGEDRFYRRHPEAEMDRAHHHGGHGSTQPEKPSLPQKQS
SLRSRKLPDMGCSLPEHRAHQEASHRQFCESKNGPPYPQGAGQLDYGSKGIPDTSEPVSY
HNSGVKYAASGQESLRLNHKEVRLSKEMERPWVRQPSAPEKHSRDCYKEEEHLTQSIVPP
PKPERSHSLKLHHTQNVERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVF
GGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
GenBank ID Protein 218083800
UniProtKB/Swiss-Prot ID A7KAX9
UniProtKB/Swiss-Prot Entry Name RHG32_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001142685.1
GeneCard ID ARHGAP32
GenAtlas ID ARHGAP32
HGNC ID HGNC:17399
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  6. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  7. Nakamura T, Komiya M, Sone K, Hirose E, Gotoh N, Morii H, Ohta Y, Mori N: Grit, a GTPase-activating protein for the Rho family, regulates neurite extension through association with the TrkA receptor and N-Shc and CrkL/Crk adapter molecules. Mol Cell Biol. 2002 Dec;22(24):8721-34. [PubMed:12446789 ]
  8. Zhao C, Ma H, Bossy-Wetzel E, Lipton SA, Zhang Z, Feng GS: GC-GAP, a Rho family GTPase-activating protein that interacts with signaling adapters Gab1 and Gab2. J Biol Chem. 2003 Sep 5;278(36):34641-53. Epub 2003 Jun 19. [PubMed:12819203 ]
  9. Hayashi T, Okabe T, Nasu-Nishimura Y, Sakaue F, Ohwada S, Matsuura K, Akiyama T, Nakamura T: PX-RICS, a novel splicing variant of RICS, is a main isoform expressed during neural development. Genes Cells. 2007 Aug;12(8):929-39. [PubMed:17663722 ]
  10. Taniguchi S, Liu H, Nakazawa T, Yokoyama K, Tezuka T, Yamamoto T: p250GAP, a neural RhoGAP protein, is associated with and phosphorylated by Fyn. Biochem Biophys Res Commun. 2003 Jun 20;306(1):151-5. [PubMed:12788081 ]
  11. Moon SY, Zang H, Zheng Y: Characterization of a brain-specific Rho GTPase-activating protein, p200RhoGAP. J Biol Chem. 2003 Feb 7;278(6):4151-9. Epub 2002 Nov 25. [PubMed:12454018 ]
  12. Okabe T, Nakamura T, Nishimura YN, Kohu K, Ohwada S, Morishita Y, Akiyama T: RICS, a novel GTPase-activating protein for Cdc42 and Rac1, is involved in the beta-catenin-N-cadherin and N-methyl-D-aspartate receptor signaling. J Biol Chem. 2003 Mar 14;278(11):9920-7. Epub 2003 Jan 16. [PubMed:12531901 ]
  13. Nakazawa T, Watabe AM, Tezuka T, Yoshida Y, Yokoyama K, Umemori H, Inoue A, Okabe S, Manabe T, Yamamoto T: p250GAP, a novel brain-enriched GTPase-activating protein for Rho family GTPases, is involved in the N-methyl-d-aspartate receptor signaling. Mol Biol Cell. 2003 Jul;14(7):2921-34. Epub 2003 Apr 4. [PubMed:12857875 ]