You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07987
Secondary Accession Numbers
  • 13698
Name Sodium- and chloride-dependent transporter XTRP3
Synonyms
  1. Sodium/imino-acid transporter 1
  2. Solute carrier family 6 member 20
  3. Transporter rB21A homolog
Gene Name SLC6A20
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Mediates the calcium-dependent uptake of imino acids such as L-proline, N-methyl-L-proline and pipecolate as well as N- methylated amino acids
Pathways
  • Amiloride Action Pathway
  • Bendroflumethiazide Action Pathway
  • Blue diaper syndrome
  • Bumetanide Action Pathway
  • Chlorothiazide Action Pathway
  • Chlorthalidone Action Pathway
  • Cyclothiazide Action Pathway
  • Cystinuria
  • Eplerenone Action Pathway
  • Ethacrynic Acid Action Pathway
  • Furosemide Action Pathway
  • Glucose Transporter Defect (SGLT2)
  • Glucose Transporter Defect (SGLT2)
  • Hartnup Disorder
  • Hydrochlorothiazide Action Pathway
  • Hydroflumethiazide Action Pathway
  • Iminoglycinuria
  • Indapamide Action Pathway
  • Kidney Function
  • Lysinuric Protein Intolerance
  • Lysinuric protein intolerance (LPI)
  • Methyclothiazide Action Pathway
  • Metolazone Action Pathway
  • Polythiazide Action Pathway
  • Quinethazone Action Pathway
  • Spironolactone Action Pathway
  • Torsemide Action Pathway
  • Triamterene Action Pathway
  • Trichlormethiazide Action Pathway
Reactions Not Available
GO Classification
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Multi-pass membrane protein
  2. Apical cell membrane
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.3
SNPs SLC6A20
Gene Sequence
>1779 bp
ATGGAGAAAGCGCGGCCGCTGTGGGCCAACTCGCTACAGTTCGTGTTCGCCTGCATCTCG
TACGCCGTGGGCCTGGGCAACGTGTGGCGATTCCCGTACCTGTGCCAGATGTACGGCGGA
GGTAGTTTCCTGGTCCCCTACATCATCATGCTTATCGTGGAGGGAATGCCGCTCTTGTAC
CTGGAACTGGCTGTGGGGCAGCGCATGCGGCAGGGCAGCATCGGCGCCTGGAGGACCATC
AGCCCGTACCTCAGTGGTGTCGGGGTCGCCAGCGTGGTGGTCTCTTTCTTCCTCTCCATG
TACTACAACGTCATCAACGCCTGGGCCTTCTGGTACCTCTTCCACTCCTTCCAGGATCCC
CTGCCGTGGTCTGTCTGCCCACTGAATGGTAACCACACGGGCTACGATGAGGAGTGTGAG
AAGGCGTCCTCCACACAGTACTTCTGGTACAGGAAAACCCTCAATATCTCGCCGTCCCTC
CAGGAGAACGGGGGTGTGCAGTGGGAGCCGGCGCTGTGCCTCCTCCTGGCCTGGCTGGTG
GTGTACCTGTGCATCCTGCGTGGCACCGAGTCCACTGGCAAGGTGGTGTATTTCACGGCG
TCACTGCCCTATTGCGTGCTCATCATCTACCTCATCAGGGGCCTCACGCTCCACGGAGCC
ACCAATGGCCTCATGTACATGTTCACTCCCAAGATAGAGCAGCTGGCCAACCCCAAGGCC
TGGATCAATGCAGCCACCCAGATCTTCTTCTCACTTGGCCTGGGCTTCGGCAGCCTGATC
GCCTTCGCCAGCTACAATGAGCCATCCAACAACTGCCAGAAGCACGCCATCATCGTGTCC
CTCATCAACAGCTTCACCTCCATATTTGCCAGCATTGTCACCTTCTCCATCTATGGCTTC
AAGGCCACCTTCAATTATGAAAACTGCTTGAAGAAGGTGAGTCTGCTGCTGACCAACACT
TTTGACCTTGAAGATGGCTTTTTGACAGCCAGCAACCTGGAGCAGGTGAAGGGCTACCTC
GCATCTGCCTACCCAAGCAAATACAGCGAGATGTTCCCGCAAATCAAAAACTGCAGCTTG
GAATCGGAGCTAGACACGGCCGTCCAGGGCACTGGCCTGGCATTCATCGTCTACACAGAG
GCCATTAAAAACATGGAGGTGTCCCAGCTGTGGTCGGTGCTCTACTTCTTCATGCTGCTG
ATGCTGGGCATTGGGAGCATGCTGGGGAACACAGCGGCCATCCTCACCCCTCTGACAGAC
AGCAAGATCATCTCCAGCCACCTGCCCAAGGAGGCCATCTCAGGTCTGGTGTGCCTTGTC
AACTGTGCCATTGGCATGGTGTTCACGATGGAGGCTGGGAACTACTGGTTTGACATATTC
AACGACTACGCGGCCACACTGTCCCTGCTGCTCATCGTGCTGGTGGAGACGATTGCCGTG
TGCTACGTGTACGGGCTGAGGAGATTTGAAAGTGACCTTAAGGCCATGACCGGCCGAGCT
GTGAGCTGGTACTGGAAGGTGATGTGGGCTGGCGTAAGCCCACTGCTGATTGTCAGCCTC
TTTGTCTTCTACCTGAGCGACTACATCCTCACGGGGACCCTGAAGTATCAAGCCTGGGAC
GCCTCCCAGGGCCAGCTCGTGACCAAAGATTACCCGGCCTATGCACTGGCTGTCATCGGG
CTGCTTGTGGCCTCCTCCACCATGTGCATCCCCCTGGCGGCCCTGGGGACTTTTGTTCAG
CGTCGCCTCAAGAGGGGAGACGCAGACCCCGTGGCCTGA
Protein Properties
Number of Residues 592
Molecular Weight 65913.3
Theoretical pI 6.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 6-26
  • 43-63
  • 80-100
  • 166-186
  • 195-215
  • 242-262
  • 277-297
  • 390-410
  • 432-452
  • 466-486
  • 505-525
  • 555-575
Protein Sequence
>Sodium- and chloride-dependent transporter XTRP3
MEKARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLY
LELAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDP
LPWSVCPLNGNHTGYDEECEKASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLV
VYLCILRGTESTGKVVYFTASLPYCVLIIYLIRGLTLHGATNGLMYMFTPKIEQLANPKA
WINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVSLINSFTSIFASIVTFSIYGF
KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSL
ESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD
SKIISSHLPKEAISGLVCLVNCAIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAV
CYVYGLRRFESDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWD
ASQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPVA
GenBank ID Protein 11181770
UniProtKB/Swiss-Prot ID Q9NP91
UniProtKB/Swiss-Prot Entry Name S6A20_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020208.3
GeneCard ID SLC6A20
GenAtlas ID SLC6A20
HGNC ID HGNC:30927
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Kiss H, Kedra D, Kiss C, Kost-Alimova M, Yang Y, Klein G, Imreh S, Dumanski JP: The LZTFL1 gene is a part of a transcriptional map covering 250 kb within the common eliminated region 1 (C3CER1) in 3p21.3. Genomics. 2001 Apr 1;73(1):10-9. [PubMed:11352561 ]
  3. Nash SR, Giros B, Kingsmore SF, Kim KM, el-Mestikawy S, Dong Q, Fumagalli F, Seldin MF, Caron MG: Cloning, gene structure and genomic localization of an orphan transporter from mouse kidney with six alternatively-spliced isoforms. Receptors Channels. 1998;6(2):113-28. [PubMed:9932288 ]
  4. Takanaga H, Mackenzie B, Suzuki Y, Hediger MA: Identification of mammalian proline transporter SIT1 (SLC6A20) with characteristics of classical system imino. J Biol Chem. 2005 Mar 11;280(10):8974-84. Epub 2005 Jan 4. [PubMed:15632147 ]