You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07990
Secondary Accession Numbers
  • 13701
Name Protein transport protein Sec31A
Synonyms
  1. ABP125
  2. ABP130
  3. SEC31-like protein 1
  4. SEC31-related protein A
  5. Web1-like protein
Gene Name SEC31A
Protein Type Unknown
Biological Properties
General Function Transcription
Specific Function Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Cytoplasmic vesicle
  5. Endoplasmic reticulum membrane
  6. Cytoplasmic side
  7. COPII-coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:4
Locus 4q21.22
SNPs SEC31A
Gene Sequence
>3663 bp
ATGAAGTTAAAGGAAGTAGATCGTACAGCCATGCAGGCATGGAGCCCTGCCCAGAATCAC
CCCATTTACCTAGCAACAGGAACATCTGCTCAGCAATTGGATGCAACATTTAGTACGAAT
GCTTCCCTTGAGATATTTGAATTAGACCTCTCTGATCCATCCTTGGATATGAAATCTTGT
GCCACATTCTCCTCTTCTCACAGGTACCACAAGTTGATTTGGGGGCCTTATAAAATGGAT
TCCAAAGGAGATGTCTCTGGAGTTCTGATTGCAGGTGGTGAAAATGGAAATATTATTCTC
TATGATCCTTCTAAAATTATAGCTGGAGACAAGGAAGTTGTGATTGCCCAGAATGACAAG
CATACTGGCCCAGTGAGAGCCTTGGATGTGAACATTTTCCAGACTAATCTGGTAGCTTCT
GGTGCTAATGAATCTGAAATCTACATATGGGATCTAAATAATTTTGCAACCCCAATGACA
CCAGGAGCCAAAACACAGCCGCCAGAAGATATCAGCTGCATTGCATGGAACAGACAAGTT
CAGCATATTTTAGCATCAGCCAGTCCCAGTGGCCGGGCCACTGTATGGGATCTTAGAAAA
AATGAGCCAATCATCAAAGTCAGTGACCATAGTAACAGAATGCATTGTTCTGGGTTGGCA
TGGCATCCTGATGTTGCTACTCAGATGGTCCTTGCCTCCGAGGATGACCGGTTACCAGTG
ATCCAGATGTGGGATCTTCGATTTGCTTCCTCTCCACTTCGTGTCCTGGAAAACCATGCC
AGGGGGATTTTGGCAATTGCTTGGAGCATGGCAGATCCTGAATTGTTACTGAGCTGTGGA
AAAGATGCTAAGATTCTCTGCTCCAATCCAAACACAGGAGAGGTGTTATATGAACTTCCC
ACCAACACACAGTGGTGCTTCGATATTCAGTGGTGTCCCCGAAATCCTGCTGTCTTATCA
GCTGCTTCGTTTGATGGGCGTATCAGTGTTTATTCTATCATGGGAGGAAGCACAGATGGT
TTAAGACAGAAACAAGTTGACAAGCTTTCATCATCTTTTGGGAATCTTGATCCCTTTGGC
ACAGGACAGCCCCTTCCTCCGTTACAAATTCCACAGCAGACTGCTCAGCATAGTATAGTG
CTGCCTCTGAAGAAGCCGCCCAAGTGGATTCGAAGGCCTGTTGGTGCTTCTTTTTCATTT
GGAGGCAAACTGGTTACGTTTGAGAATGTCAGAATGCCTTCTCATCAGGGAGCTGAGCAG
CAGCAGCAGCAGCACCATGTGTTCATTAGTCAGGTTGTAACAGAAAAGGAGTTCCTCAGC
CGATCAGACCAACTTCAGCAGGCTGTGCAGTCACAAGGATTTATCAATTATTGCCAAAAA
AAAATTGATGCTTCTCAGACTGAATTTGAGAAAAATGTGTGGTCCTTTTTGAAGGTAAAC
TTTGAGGATGATTCTCGTGGAAAATACCTTGAACTTCTAGGATACAGAAAAGAAGATCTA
GGAAAGAAGATTGCTTTGGCCTTGAACAAAGTGGATGGAGCCAATGTGGCTCTTAAAGAC
TCTGACCAAGTAGCACAGAGTGATGGGGAGGAGAGCCCTGCTGCTGAAGAGCAGCTCTTG
GGAGAGCACATTAAAGAGGAAAAAGAAGAATCTGAATTTCTACCCTCATCTGGAGGAACA
TTTAATATCTCTGTCAGTGGGGACATTGATGGTTTAATTACTCAGGCTTTGCTGACGGGC
AATTTTGAGAGTGCTGTTGACCTTTGTTTACATGATAACCGCATGGCCGATGCCATTATA
TTGGCCATAGCAGGTGGACAAGAACTCTTGGCTCGAACCCAGAAAAAATACTTCGCAAAA
TCCCAAAGCAAAATTACCAGGCTCATCACTGCAGTGGTGATGAAGAACTGGAAAGAGATT
GTTGAGTCTTGTGATCTTAAAAATTGGAGAGAGGCTTTAGCTGCAGTATTGACTTATGCA
AAGCCGGATGAATTTTCAGCCCTTTGTGATCTTTTGGGAACCAGGCTTGAAAATGAAGGA
GATAGCCTCCTGCAGACTCAAGCATGTCTCTGCTATATTTGTGCAGGGAATGTAGAGAAA
TTAGTTGCATGTTGGACTAAAGCTCAAGATGGAAGCCACCCTTTGTCACTTCAGGATCTG
ATTGAGAAAGTTGTCATCCTGCGAAAAGCTGTGCAACTCACTCAAGCCATGGACACTAGT
ACTGTAGGAGTTCTCTTGGCTGCGAAGATGAGTCAGTATGCCAATTTGTTGGCAGCTCAG
GGCAGTATTGCTGCAGCCTTGGCTTTTCTTCCTGACAACACCAACCAGCCAAATATCATG
CAGCTTCGTGACAGACTTTGTAGAGCACAAGGAGAGCCTGTAGCAGGACATGAATCACCT
AAAATTCCGTACGAGAAACAGCAGCTCCCCAAGGGCAGGCCTGGACCAGTTGCTGGCCAC
CACCAGATGCCAAGAGTTCAAACTCAACAATATTATCCCCATGGAGAAAATCCTCCACCT
CCGGGTTTCATAATGCATGGAAATGTTAATCCAAATGCTGCTGGTCAGCTTCCCACATCT
CCAGGTCATATGCACACCCAGGTACCACCTTATCCACAGCCACAGCCTTATCAACCAGCC
CAGCCGTATCCCTTCGGAACAGGGGGGTCAGCAATGTATCGACCTCAGCAGCCTGTTGCT
CCTCCTACTTCAAACGCTTACCCTAACACCCCTTACATATCTTCTGCTTCTTCCTATACT
GGGCAGTCTCAGCTGTACGCAGCACAGCACCAGGCCTCTTCACCTACCTCCAGCCCTGCT
ACTTCTTTCCCTCCTCCCCCTTCCTCTGGAGCATCCTTCCAGCATGGCGGACCAGGAGCT
CCACCATCATCTTCAGCTTATGCACTGCCTCCTGGAACAACAGGTACACTGCCTGCTGCC
AGTGAGCTGCCTGCGTCCCAAAGAACAGGTCCTCAGAATGGTTGGAATGACCCTCCAGCT
TTGAACAGAGTACCCAAAAAGAAGAAGATGCCTGAAAACTTCATGCCTCCTGTTCCCATC
ACATCACCAATCATGAACCCGTTGGGTGACCCCCAGTCACAAATGCTGCAGCAACAGCCT
TCAGCTCCAGTACCACTGTCAAGCCAGTCTTCATTCCCACAGCCACATCTTCCAGGTGGC
CAGCCCTTCCATGGCGTACAGCAACCTCTTGGTCAAACAGGCATGCCACCATCTTTTTCA
AAGCCCAATATTGAAGGTGCCCCAGGGGCTCCTATTGGAAATACCTTCCAGCATGTGCAG
TCTTTGCCAACAAAAAAAATTACCAAGAAACCTATTCCAGATGAGCACCTCATTCTAAAG
ACCACATTTGAGGATCTTATTCAGCGCTGCCTTTCTTCAGCAACAGACCCTCAAACCAAG
AGGAAGCTAGATGATGCCAGCAAACGTTTGGAGTTTCTGTATGATAAACTTAGGGAACAG
ACACTTTCACCAACAATCACCAGTGGTTTACACAACATTGCAAGGAGCATTGAAACTCGA
AACTACTCAGAAGGATTGACCATGCATACCCACATAGTTAGCACCAGCAACTTCAGTGAG
ACCTCTGCTTTCATGCCAGTTCTCAAAGTTGTTCTCACCCAGGCCAATAAGCTGGGTGTC
TAA
Protein Properties
Number of Residues 1220
Molecular Weight 133013.6
Theoretical pI 6.89
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein transport protein Sec31A
MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
IQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVN
FEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLL
GEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAII
LAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYA
KPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDL
IEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIM
QLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVA
PPTSNAYPNTPYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGA
PPSSSAYALPPGTTGTLPAASELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPI
TSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFS
KPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTK
RKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSE
TSAFMPVLKVVLTQANKLGV
GenBank ID Protein 116256338
UniProtKB/Swiss-Prot ID O94979
UniProtKB/Swiss-Prot Entry Name SC31A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001077207.2
GeneCard ID SEC31A
GenAtlas ID SEC31A
HGNC ID HGNC:17052
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]
  7. Panagopoulos I, Nilsson T, Domanski HA, Isaksson M, Lindblom P, Mertens F, Mandahl N: Fusion of the SEC31L1 and ALK genes in an inflammatory myofibroblastic tumor. Int J Cancer. 2006 Mar 1;118(5):1181-6. [PubMed:16161041 ]
  8. Yamasaki A, Tani K, Yamamoto A, Kitamura N, Komada M: The Ca2+-binding protein ALG-2 is recruited to endoplasmic reticulum exit sites by Sec31A and stabilizes the localization of Sec31A. Mol Biol Cell. 2006 Nov;17(11):4876-87. Epub 2006 Sep 6. [PubMed:16957052 ]
  9. Tang BL, Zhang T, Low DY, Wong ET, Horstmann H, Hong W: Mammalian homologues of yeast sec31p. An ubiquitously expressed form is localized to endoplasmic reticulum (ER) exit sites and is essential for ER-Golgi transport. J Biol Chem. 2000 May 5;275(18):13597-604. [PubMed:10788476 ]
  10. Shugrue CA, Kolen ER, Peters H, Czernik A, Kaiser C, Matovcik L, Hubbard AL, Gorelick F: Identification of the putative mammalian orthologue of Sec31P, a component of the COPII coat. J Cell Sci. 1999 Dec;112 ( Pt 24):4547-56. [PubMed:10574704 ]
  11. Shibata H, Suzuki H, Yoshida H, Maki M: ALG-2 directly binds Sec31A and localizes at endoplasmic reticulum exit sites in a Ca2+-dependent manner. Biochem Biophys Res Commun. 2007 Feb 16;353(3):756-63. Epub 2006 Dec 22. [PubMed:17196169 ]