You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08008
Secondary Accession Numbers
  • 13719
Name Somatostatin receptor type 2
Synonyms
  1. SRIF-1
  2. SS-2-R
  3. SS2-R
  4. SS2R
Gene Name SSTR2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for somatostatins-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. In RIN-5F cells, this receptor inhibits calcium entry by suppressing voltage dependent calcium-channels
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neuropeptide receptor activity
receptor activity
somatostatin receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q24
SNPs SSTR2
Gene Sequence
>1110 bp
ATGGACATGGCGGATGAGCCACTCAATGGAAGCCACACATGGCTATCCATTCCATTTGAC
CTCAATGGCTCTGTGGTGTCAACCAACACCTCAAACCAGACAGAGCCGTACTATGACCTG
ACAAGCAATGCAGTCCTCACATTCATCTATTTTGTGGTCTGCATCATTGGGTTGTGTGGC
AACACACTTGTCATTTATGTCATCCTCCGCTATGCCAAGATGAAGACCATCACCAACATT
TACATCCTCAACCTGGCCATCGCAGATGAGCTCTTCATGCTGGGTCTGCCTTTCTTGGCT
ATGCAGGTGGCTCTGGTCCACTGGCCCTTTGGCAAGGCCATTTGCCGGGTGGTCATGACT
GTGGATGGCATCAATCAGTTCACCAGCATCTTCTGCCTGACAGTCATGAGCATCGACCGA
TACCTGGCTGTGGTCCACCCCATCAAGTCGGCCAAGTGGAGGAGACCCCGGACGGCCAAG
ATGATCACCATGGCTGTGTGGGGAGTCTCTCTGCTGGTCATCTTGCCCATCATGATATAT
GCTGGGCTCCGGAGCAACCAGTGGGGGAGAAGCAGCTGCACCATCAACTGGCCAGGTGAA
TCTGGGGCTTGGTACACAGGGTTCATCATCTACACTTTCATTCTGGGGTTCCTGGTACCC
CTCACCATCATCTGTCTTTGCTACCTGTTCATTATCATCAAGGTGAAGTCCTCTGGAATC
CGAGTGGGCTCCTCTAAGAGGAAGAAGTCTGAGAAGAAGGTCACCCGAATGGTGTCCATC
GTGGTGGCTGTCTTCATCTTCTGCTGGCTTCCCTTCTACATATTCAACGTTTCTTCCGTC
TCCATGGCCATCAGCCCCACCCCAGCCCTTAAAGGCATGTTTGACTTTGTGGTGGTCCTC
ACCTATGCTAACAGCTGTGCCAACCCTATCCTATATGCCTTCTTGTCTGACAACTTCAAG
AAGAGCTTCCAGAATGTCCTCTGCTTGGTCAAGGTGAGCGGCACAGATGATGGGGAGCGG
AGTGACAGTAAGCAGGACAAATCCCGGCTGAATGAGACCACGGAGACCCAGAGGACCCTC
CTCAATGGAGACCTCCAAACCAGTATCTGA
Protein Properties
Number of Residues 369
Molecular Weight 41332.4
Theoretical pI 9.18
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 44-67
  • 79-103
  • 119-138
  • 162-181
  • 208-229
  • 254-278
  • 289-303
Protein Sequence
>Somatostatin receptor type 2
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P30874
UniProtKB/Swiss-Prot Entry Name SSR2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK290745
GeneCard ID SSTR2
GenAtlas ID SSTR2
HGNC ID HGNC:11331
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yamada Y, Post SR, Wang K, Tager HS, Bell GI, Seino S: Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney. Proc Natl Acad Sci U S A. 1992 Jan 1;89(1):251-5. [PubMed:1346068 ]
  4. Petersenn S, Rasch AC, Presch S, Beil FU, Schulte HM: Genomic structure and transcriptional regulation of the human somatostatin receptor type 2. Mol Cell Endocrinol. 1999 Nov 25;157(1-2):75-85. [PubMed:10619399 ]
  5. Patel YC, Greenwood M, Kent G, Panetta R, Srikant CB: Multiple gene transcripts of the somatostatin receptor SSTR2: tissue selective distribution and cAMP regulation. Biochem Biophys Res Commun. 1993 Apr 15;192(1):288-94. [PubMed:8386508 ]
  6. Zitzer H, Honck HH, Bachner D, Richter D, Kreienkamp HJ: Somatostatin receptor interacting protein defines a novel family of multidomain proteins present in human and rodent brain. J Biol Chem. 1999 Nov 12;274(46):32997-3001. [PubMed:10551867 ]