You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08020
Secondary Accession Numbers
  • 13731
Name Synaptic vesicle glycoprotein 2A
Synonyms Not Available
Gene Name SV2A
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Multi-pass membrane protein
  3. secretory vesicle
  4. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21.2
SNPs SV2A
Gene Sequence
>2229 bp
ATGGAAGAGGGCTTCCGAGACCGGGCAGCTTTCATCCGTGGGGCCAAAGACATTGCTAAG
GAAGTCAAAAAGCATGCGGCCAAGAAGGTGGTGAAGGGCCTGGACAGAGTCCAGGACGAA
TATTCCCGAAGATCGTACTCCCGCTTTGAGGAGGAGGATGATGATGATGACTTCCCTGCT
CCCAGTGATGGTTATTACCGAGGAGAAGGGACCCAGGATGAGGAGGAAGGTGGTGCATCC
AGTGATGCTACTGAGGGCCATGACGAGGATGATGAGATCTATGAAGGGGAATATCAGGGC
ATTCCCCGGGCAGAGTCTGGGGGCAAAGGCGAGCGGATGGCAGATGGGGCGCCCCTGGCT
GGAGTAAGGGGGGGCTTGAGTGATGGGGAGGGTCCCCCTGGGGGCCGGGGGGAGGCACAA
CGACGGAAAGAACGAGAAGAACTGGCCCAACAGTATGAAGCCATCCTACGGGAGTGTGGC
CACGGCCGCTTCCAGTGGACACTGTATTTTGTGCTTGGTCTGGCGCTGATGGCTGACGGT
GTGGAGGTCTTTGTGGTGGGCTTCGTGCTGCCCAGCGCTGAGAAAGACATGTGCCTGTCC
GACTCCAACAAAGGCATGCTAGGCCTCATCGTCTACCTGGGCATGATGGTGGGAGCCTTC
CTCTGGGGAGGTCTGGCTGACCGGCTGGGTCGGAGGCAGTGTCTGCTCATCTCGCTCTCA
GTCAACAGCGTCTTCGCCTTCTTCTCATCTTTTGTCCAGGGTTACGGCACTTTCCTCTTC
TGCCGCCTACTTTCTGGGGTTGGGATTGGAGGGTCCATCCCCATTGTCTTCTCCTATTTC
TCCGAGTTTCTGGCCCAGGAGAAACGAGGGGAGCATTTGAGCTGGCTCTGCATGTTTTGG
ATGATTGGTGGCGTGTACGCAGCTGCTATGGCCTGGGCCATCATCCCCCACTATGGGTGG
AGTTTTCAGATGGGTTCTGCCTACCAGTTCCACAGCTGGAGGGTCTTCGTCCTCGTCTGC
GCCTTTCCTTCTGTGTTTGCCATTGGGGCTCTGACCACGCAGCCTGAGAGCCCCCGTTTC
TTCCTAGAGAATGGAAAGCATGATGAGGCCTGGATGGTGCTGAAGCAGGTCCATGATACC
AACATGCGAGCCAAAGGACATCCTGAGCGAGTGTTCTCAGTAACCCACATTAAGACGATT
CATCAGGAGGATGAATTGATTGAGATCCAGTCGGACACAGGGACCTGGTACCAGCGCTGG
GGGGTCCGGGCCTTGAGCCTAGGGGGGCAGGTTTGGGGGAATTTTCTCTCCTGTTTTGGT
CCCGAATATCGGCGCATCACTCTGATGATGATGGGTGTGTGGTTCACCATGTCATTCAGC
TACTATGGCCTGACCGTCTGGTTTCCTGACATGATCCGCCATCTCCAGGCAGTGGACTAC
GCATCCCGCACCAAAGTGTTCCCCGGGGAGCGCGTAGAGCATGTAACTTTTAACTTCACG
TTGGAGAATCAGATCCACCGAGGCGGGCAGTACTTCAATGACAAGTTCATTGGGCTGCGG
CTCAAGTCAGTGTCCTTTGAGGATTCCCTGTTTGAAGAGTGTTATTTTGAGGATGTCACA
TCCAGCAACACGTTTTTCCGCAACTGCACATTCATCAACACTGTGTTCTATAACACTGAC
CTGTTCGAGTACAAGTTTGTGAACAGCCGTCTGATAAACAGTACATTCCTGCACAACAAG
GAGGGCTGCCCGCTAGACGTGACAGGGACGGGCGAAGGTGCCTACATGGTATACTTTGTG
AGCTTCCTGGGGACACTGGCAGTGCTTCCTGGGAATATCGTGTCTGCCCTGCTCATGGAC
AAGATCGGCAGGCTCAGAATGCTTGCTGGCTCCAGCGTGATGTCCTGTGTCTCCTGCTTC
TTCCTGTCTTTTGGGAACAGTGAGTCGGCCATGATCGCTCTGCTCTGCCTTTTTGGCGGG
GTCAGCATTGCATCCTGGAATGCGCTGGACGTGTTGACTGTTGAACTCTACCCCTCAGAC
AAGAGGACCACAGCTTTTGGCTTCCTGAATGCCCTGTGTAAGCTGGCAGCTGTGCTGGGG
ATCAGCATCTTCACATCCTTCGTGGGAATCACCAAGGCTGCACCCATCCTCTTTGCCTCA
GCTGCCCTTGCCCTTGGCAGCTCTCTGGCCCTGAAGCTGCCTGAGACCCGGGGGCAGGTG
CTGCAGTGA
Protein Properties
Number of Residues 742
Molecular Weight 82694.7
Theoretical pI 5.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 170-190
  • 206-226
  • 234-254
  • 263-283
  • 295-315
  • 335-355
  • 448-468
  • 599-619
  • 627-647
  • 652-672
  • 686-708
  • 713-731
Protein Sequence
>Synaptic vesicle glycoprotein 2A
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPA
PSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
ASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
GenBank ID Protein 216548223
UniProtKB/Swiss-Prot ID Q7L0J3
UniProtKB/Swiss-Prot Entry Name SV2A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014849.3
GeneCard ID SV2A
GenAtlas ID SV2A
HGNC ID HGNC:20566
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  6. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  7. DeGiorgis JA, Jaffe H, Moreira JE, Carlotti CG Jr, Leite JP, Pant HC, Dosemeci A: Phosphoproteomic analysis of synaptosomes from human cerebral cortex. J Proteome Res. 2005 Mar-Apr;4(2):306-15. [PubMed:15822905 ]
  8. Lynch BA, Lambeng N, Nocka K, Kensel-Hammes P, Bajjalieh SM, Matagne A, Fuks B: The synaptic vesicle protein SV2A is the binding site for the antiepileptic drug levetiracetam. Proc Natl Acad Sci U S A. 2004 Jun 29;101(26):9861-6. Epub 2004 Jun 21. [PubMed:15210974 ]