You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08021
Secondary Accession Numbers
  • 13732
Name Synaptic vesicle glycoprotein 2B
Synonyms Not Available
Gene Name SV2B
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Probably plays a role in the control of regulated secretion in neural and endocrine cells
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Cytoplasmic vesicle
  3. Multi-pass membrane protein
  4. secretory vesicle
  5. secretory vesicle
  6. acrosome
  7. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 15q26.1
SNPs SV2B
Gene Sequence
>2052 bp
ATGGATGACTACAAGTATCAGGACAATTATGGGGGCTATGCTCCCAGTGATGGCTATTAC
CGCGGCAATGAGTCCAACCCAGAAGAAGATGCACAGAGTGATGTCACCGAAGGCCATGAT
GAGGAAGACGAGATCTATGAGGGCGAGTACCAGGGTATCCCTCACCCAGATGATGTCAAG
GCCAAGCAGGCCAAGATGGCGCCCTCCAGAATGGACAGCCTTCGGGGCCAGACAGACCTG
ATGGCTGAGAGGCTGGAAGATGAGGAGCAGTTGGCCCACCAGTACGAGACCATCATGGAT
GAGTGTGGCCATGGCCGCTTCCAGTGGATCCTCTTTTTCGTCTTGGGTTTGGCCCTGATG
GCCGATGGGGTGGAAGTGTTCGTGGTGAGTTTTGCCCTGCCCAGTGCAGAGAAGGACATG
TGTCTGTCCAGTTCCAAAAAAGGAATGCTAGGGATGATAGTCTACTTGGGAATGATGGCG
GGCGCCTTCATCCTGGGAGGCCTGGCTGATAAGCTGGGAAGGAAGCGAGTCCTCAGCATG
TCTCTGGCCGTCAATGCCTCCTTCGCCTCCCTCTCTTCCTTCGTGCAGGGATATGGAGCC
TTCCTCTTCTGCCGACTCATCTCAGGCATCGGTATTGGGGGTGCTCTACCGATTGTTTTT
GCCTATTTTTCTGAATTCTTGTCTCGGGAGAAGCGAGGAGAACACCTCAGTTGGCTGGGC
ATCTTCTGGATGACTGGGGGCCTGTACGCATCTGCCATGGCCTGGAGCATCATCCCACAC
TATGGCTGGGGCTTCAGCATGGGGACCAATTACCACTTCCATAGCTGGAGAGTGTTTGTC
ATCGTCTGTGCTCTGCCCTGCACCGTGTCCATGGTGGCCCTGAAGTTCATGCCAGAGAGC
CCAAGGTTTCTGCTAGAGATGGGCAAACATGATGAAGCCTGGATGATTCTCAAGCAAGTC
CATGACACCAACATGAGAGCTAAGGGGACCCCAGAGAAAGTGTTCACGGTTTCCAACATC
AAAACTCCCAAGCAAATGGATGAATTCATTGAGATCCAAAGTTCAACAGGAACCTGGTAC
CAGCGCTGGCTGGTCAGATTCAAGACCATTTTCAAGCAGGTCTGGGATAATGCCCTGTAC
TGTGTGATGGGGCCCTACAGAATGAATACACTGATTCTGGCCGTGGTTTGGTTTGCCATG
GCATTCAGTTACTATGGACTGACAGTTTGGTTTCCTGATATGATCCGCTATTTTCAAGAT
GAAGAATACAAGTCTAAAATGAAGGTGTTTTTTGGTGAGCATGTGTACGGCGCCACAATC
AACTTCACGATGGAAAATCAGATCCACCAACATGGGAAACTTGTGAATGATAAGTTCACA
AGAATGTACTTTAAACATGTACTCTTTGAGGACACATTCTTTGACGAGTGCTATTTTGAA
GACGTAACATCAACAGATACCTACTTCAAAAATTGTACCATTGAATCAACCATCTTTTAC
AACACAGACCTCTACGAGCACAAGTTCATCAACTGTCGGTTTATCAACTCCACCTTCCTG
GAGCAGAAGGAGGGCTGCCACATGGACTTGGAGCAAGATAATGACTTCCTGATTTACCTC
GTCAGCTTCCTGGGCAGCCTGTCTGTCTTACCCGGGAACATCATTTCTGCCCTGCTCATG
GATAGAATTGGAAGGCTCAAGATGATTGGTGGCTCCATGCTAATCTCTGCAGTCTGCTGC
TTCTTCCTGTTTTTTGGCAACAGTGAGTCTGCAATGATCGGCTGGCAGTGCCTGTTCTGT
GGGACAAGCATTGCAGCCTGGAATGCTCTGGATGTGATCACAGTGGAGCTGTATCCCACC
AACCAGAGAGCAACAGCCTTCGGCATTCTCAATGGATTATGCAAATTTGGCGCCATCCTG
GGAAACACCATCTTTGCTTCTTTTGTTGGGATAACCAAAGTGGTCCCCATCCTTCTGGCT
GCTGCTTCTCTGGTTGGGGGTGGCCTGATTGCCCTTCGACTGCCAGAGACTCGAGAACAG
GTCCTGATGTGA
Protein Properties
Number of Residues 683
Molecular Weight 77443.7
Theoretical pI 5.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 109-129
  • 149-169
  • 183-203
  • 206-226
  • 238-258
  • 278-298
  • 391-411
  • 536-556
  • 566-586
  • 593-613
  • 627-649
  • 654-672
Protein Sequence
>Synaptic vesicle glycoprotein 2B
MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVK
AKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALM
ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSM
SLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLG
IFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPCTVSMVALKFMPES
PRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFIEIQSSTGTWY
QRWLVRFKTIFKQVWDNALYCVMGPYRMNTLILAVVWFAMAFSYYGLTVWFPDMIRYFQD
EEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFE
DVTSTDTYFKNCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEGCHMDLEQDNDFLIYL
VSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFC
GTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLA
AASLVGGGLIALRLPETREQVLM
GenBank ID Protein 7662270
UniProtKB/Swiss-Prot ID Q7L1I2
UniProtKB/Swiss-Prot Entry Name SV2B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014848.4
GeneCard ID SV2B
GenAtlas ID SV2B
HGNC ID HGNC:16874
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]