You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08028
Secondary Accession Numbers
  • 13739
Name Synaptotagmin-1
Synonyms
  1. Synaptotagmin I
  2. SytI
  3. p65
Gene Name SYT1
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
coated vesicle
clathrin-coated vesicle
synaptic vesicle
membrane
cell part
organelle
vesicle
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasm
  2. Cytoplasmic vesicle
  3. Cytoplasmic vesicle
  4. Single-pass membrane protein
  5. Single-pass membrane protein
  6. secretory vesicle
  7. secretory vesicle
  8. chromaffin granule membrane
  9. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 12cen-q21
SNPs SYT1
Gene Sequence
>1269 bp
ATGGTGAGCGAGAGTCACCATGAGGCCCTGGCAGCCCCGCCTGTCACCACTGTCGCGACT
GTTCTGCCAAGCAATGCCACAGAGCCAGCCAGTCCTGGAGAAGGAAAGGAAGATGCATTT
TCTAAGCTGAAGGAGAAGTTTATGAATGAGTTGCATAAAATTCCATTGCCACCGTGGGCC
TTAATTGCAATAGCCATAGTCGCAGTCCTTTTAGTCCTGACCTGCTGCTTTTGTATCTGT
AAGAAATGTTTGTTCAAAAAGAAAAACAAGAAGAAGGGAAAGGAAAAAGGAGGGAAGAAT
GCCATTAACATGAAAGATGTAAAAGACTTAGGGAAGACGATGAAAGATCAGGCCCTCAAG
GATGATGATGCTGAAACTGGATTGACAGATGGAGAAGAAAAAGAAGAACCCAAAGAAGAG
GAGAAACTGGGAAAACTTCAGTATTCACTGGATTATGATTTCCAAAATAACCAGCTGCTG
GTAGGGATCATTCAGGCTGCTGAACTGCCCGCCTTGGACATGGGGGGCACATCTGATCCT
TACGTGAAAGTGTTTCTGCTACCTGATAAGAAGAAGAAATTTGAGACAAAAGTCCACCGA
AAAACCCTTAATCCTGTCTTCAATGAGCAATTTACTTTCAAGGTACCATACTCGGAATTG
GGTGGCAAAACCCTAGTGATGGCTGTATATGATTTTGATCGTTTCTCTAAGCATGACATC
ATTGGAGAATTTAAAGTCCCTATGAACACAGTGGATTTTGGCCATGTAACTGAGGAATGG
CGTGACCTGCAAAGTGCTGAGAAGGAAGAGCAAGAGAAATTGGGTGATATCTGCTTCTCC
CTTCGCTACGTACCTACTGCTGGTAAGCTGACTGTTGTCATTCTGGAGGCAAAGAACCTG
AAGAAGATGGATGTGGGTGGCTTATCCGATCCTTATGTGAAGATTCATCTGATGCAGAAT
GGTAAGAGGCTGAAGAAGAAAAAGACAACAATTAAAAAGAACACACTTAACCCCTACTAC
AATGAGTCATTCAGCTTTGAAGTACCTTTTGAACAAATCCAGAAAGTGCAGGTGGTGGTA
ACTGTTTTGGACTATGACAAGATTGGCAAGAACGATGCCATCGGCAAAGTCTTTGTGGGC
TACAACAGCACCGGCGCGGAGCTGCGACACTGGTCAGACATGCTGGCCAACCCCAGGCGA
CCTATTGCCCAGTGGCACACCCTGCAGGTAGAGGAGGAAGTTGATGCCATGCTGGCCGTC
AAGAAGTAA
Protein Properties
Number of Residues 422
Molecular Weight 47572.8
Theoretical pI 8.33
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 58-80
Protein Sequence
>Synaptotagmin-1
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWA
LIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALK
DDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDP
YVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI
IGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL
KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVV
TVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
KK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P21579
UniProtKB/Swiss-Prot Entry Name SYT1_HUMAN
PDB IDs
GenBank Gene ID M55047
GeneCard ID SYT1
GenAtlas ID SYT1
HGNC ID HGNC:11509
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Perin MS, Johnston PA, Ozcelik T, Jahn R, Francke U, Sudhof TC: Structural and functional conservation of synaptotagmin (p65) in Drosophila and humans. J Biol Chem. 1991 Jan 5;266(1):615-22. [PubMed:1840599 ]
  4. Han C, Chen T, Yang M, Li N, Liu H, Cao X: Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery. J Immunol. 2009 Mar 1;182(5):2986-96. doi: 10.4049/jimmunol.0802002. [PubMed:19234194 ]