You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08029
Secondary Accession Numbers
  • 13740
Name Synaptotagmin-2
Synonyms
  1. Synaptotagmin II
  2. SytII
Gene Name SYT2
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
coated vesicle
clathrin-coated vesicle
synaptic vesicle
membrane
cell part
organelle
vesicle
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Cytoplasmic vesicle
  3. Single-pass membrane protein
  4. Single-pass membrane protein
  5. secretory vesicle
  6. secretory vesicle
  7. chromaffin granule membrane
  8. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32.1
SNPs SYT2
Gene Sequence
>1260 bp
ATGAGGAACATTTTCAAGAGGAACCAGGAGCCTATTGTGGCTCCTGCCACCACCACCGCC
ACGATGCCCATTGGACCCGTGGACAACTCCACTGAGAGTGGGGGTGCTGGGGAGAGTCAG
GAGGACATGTTTGCCAAACTGAAGGAGAAGTTATTCAATGAGATAAACAAGATTCCCTTA
CCACCCTGGGCACTGATCGCCATTGCTGTGGTTGCTGGGCTCCTGCTTCTCACCTGCTGC
TTCTGCATCTGCAAGAAATGCTGCTGCAAGAAGAAGAAGAACAAGAAGGAGAAGGGCAAA
GGCATGAAGAATGCCATGAACATGAAGGACATGAAAGGGGGTCAGGATGACGACGACGCA
GAGACAGGCCTGACTGAGGGGGAAGGTGAAGGGGAGGAGGAGAAAGAGCCAGAGAACCTG
GGCAAACTGCAGTTTTCCCTGGACTATGATTTTCAGGCTAATCAGCTTACTGTGGGCGTT
CTGCAGGCTGCTGAACTGCCTGCCCTGGACATGGGAGGCACCTCAGACCCTTATGTCAAG
GTCTTCCTCCTTCCTGACAAGAAGAAGAAATATGAGACCAAAGTCCATCGGAAGACACTG
AACCCTGCCTTCAATGAAACCTTCACCTTCAAGGTGCCATACCAGGAGCTTGGGGGCAAA
ACTCTGGTGATGGCCATCTATGACTTTGACCGCTTCTCCAAACATGACATCATTGGAGAG
GTAAAGGTGCCTATGAACACAGTGGACCTCGGCCAGCCCATTGAGGAGTGGAGAGACCTG
CAAGGCGGGGAAAAGGAGGAGCCGGAGAAGCTGGGCGACATCTGCACCTCCCTGCGCTAT
GTGCCCACGGCCGGGAAGCTCACTGTCTGCATCCTGGAGGCTAAGAACCTCAAGAAGATG
GACGTGGGCGGCCTTTCAGACCCGTACGTGAAGATCCACCTGATGCAGAATGGCAAGAGG
CTCAAGAAGAAGAAGACAACCGTGAAGAAGAAGACCCTGAACCCATACTTCAACGAGTCC
TTCAGCTTTGAGATCCCCTTCGAGCAGATTCAGAAAGTCCAGGTAGTGGTCACCGTGCTG
GACTATGACAAGCTGGGCAAGAACGAAGCCATAGGCAAGATCTTCGTGGGCAGCAATGCC
ACGGGCACAGAGCTGCGGCACTGGTCCGACATGCTGGCCAACCCCCGGAGGCCCATCGCC
CAGTGGCACTCGCTCAAGCCTGAGGAGGAGGTGGATGCACTCCTGGGCAAGAACAAGTAG
Protein Properties
Number of Residues 419
Molecular Weight 46871.9
Theoretical pI 8.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 63-83
Protein Sequence
>Synaptotagmin-2
MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPL
PPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDA
ETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVK
VFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGE
VKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKM
DVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVL
DYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N9I0
UniProtKB/Swiss-Prot Entry Name SYT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK090672
GeneCard ID SYT2
GenAtlas ID SYT2
HGNC ID HGNC:11510
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Han C, Chen T, Yang M, Li N, Liu H, Cao X: Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery. J Immunol. 2009 Mar 1;182(5):2986-96. doi: 10.4049/jimmunol.0802002. [PubMed:19234194 ]