Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08054
Secondary Accession Numbers
  • 13765
Name Tuberoinfundibular peptide of 39 residues
Synonyms
  1. Parathyroid hormone 2
  2. TIP39
Gene Name PTH2
Protein Type Unknown
Biological Properties
General Function Involved in neuropeptide signaling pathway
Specific Function Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation. Neuropeptide which may also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.33
SNPs PTH2
Gene Sequence
>303 bp
ATGGAGACCCGCCAGGTGTCCAGGAGCCCTCGGGTTCGGCTGCTGCTGCTGCTGCTGCTG
CTGCTGGTGGTGCCCTGGGGCGTCCGCACTGCCTCGGGAGTCGCCCTGCCCCCGGTCGGG
GTCCTCAGCCTCCGCCCCCCAGGACGGGCCTGGGCGGATCCCGCCACCCCCAGGCCGCGG
AGGAGCCTGGCGCTGGCGGACGACGCGGCCTTCCGGGAACGCGCGCGGTTGCTGGCCGCC
CTCGAGCGCCGCCACTGGCTGAACTCGTACATGCACAAGCTGCTGGTGTTGGATGCGCCC
TGA
Protein Properties
Number of Residues 100
Molecular Weight 11202.1
Theoretical pI 12.33
Pfam Domain Function Not Available
Signals
  • 1-30
Transmembrane Regions
  • None
Protein Sequence
>Tuberoinfundibular peptide of 39 residues
METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPR
RSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96A98
UniProtKB/Swiss-Prot Entry Name TIP39_HUMAN
PDB IDs Not Available
GenBank Gene ID AY037555
GeneCard ID PTH2
GenAtlas ID PTH2
HGNC ID HGNC:30828
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hansen IA, Jakob O, Wortmann S, Arzberger T, Allolio B, Blind E: Characterization of the human and mouse genes encoding the tuberoinfundibular peptide of 39 residues, a ligand of the parathyroid hormone receptor family. J Endocrinol. 2002 Jul;174(1):95-102. [PubMed:12098667 ]
  3. Dobolyi A, Ueda H, Uchida H, Palkovits M, Usdin TB: Anatomical and physiological evidence for involvement of tuberoinfundibular peptide of 39 residues in nociception. Proc Natl Acad Sci U S A. 2002 Feb 5;99(3):1651-6. Epub 2002 Jan 29. [PubMed:11818570 ]
  4. Della Penna K, Kinose F, Sun H, Koblan KS, Wang H: Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Neuropharmacology. 2003 Jan;44(1):141-53. [PubMed:12559132 ]
  5. John MR, Arai M, Rubin DA, Jonsson KB, Juppner H: Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues. Endocrinology. 2002 Mar;143(3):1047-57. [PubMed:11861531 ]
  6. Misiano P, Scott BB, Scheideler MA, Garnier M: PTH2 receptor-mediated inhibitory effect of parathyroid hormone and TIP39 on cell proliferation. Eur J Pharmacol. 2003 May 16;468(3):159-66. [PubMed:12754053 ]
  7. Bisello A, Manen D, Pierroz DD, Usdin TB, Rizzoli R, Ferrari SL: Agonist-specific regulation of parathyroid hormone (PTH) receptor type 2 activity: structural and functional analysis of PTH- and tuberoinfundibular peptide (TIP) 39-stimulated desensitization and internalization. Mol Endocrinol. 2004 Jun;18(6):1486-98. Epub 2004 Feb 26. [PubMed:14988434 ]