Showing Protein Troponin C, skeletal muscle (HMDBP08058)

• 13769

• Acebutolol Action Pathway
• Alprenolol Action Pathway
• Amiodarone Action Pathway
• Amlodipine Action Pathway
• Arbutamine Action Pathway
• Atenolol Action Pathway
• Betaxolol Action Pathway
• Bevantolol Action Pathway
• Bisoprolol Action Pathway
• Bopindolol Action Pathway
• Bupranolol Action Pathway
• Carteolol Action Pathway
• Carvedilol Action Pathway
• Diltiazem Action Pathway
• Disopyramide Action Pathway
• Dobutamine Action Pathway
• Epinephrine Action Pathway
• Esmolol Action Pathway
• Felodipine Action Pathway
• Flecainide Action Pathway
• Fosphenytoin (Antiarrhythmic) Action Pathway
• Ibutilide Action Pathway
• Isoprenaline Action Pathway
• Isradipine Action Pathway
• Labetalol Action Pathway
• Levobunolol Action Pathway
• Lidocaine (Antiarrhythmic) Action Pathway
• Metipranolol Action Pathway
• Metoprolol Action Pathway
• Mexiletine Action Pathway
• Muscle/Heart Contraction
• Nadolol Action Pathway
• Nebivolol Action Pathway
• Nifedipine Action Pathway
• Nimodipine Action Pathway
• Nisoldipine Action Pathway
• Nitrendipine Action Pathway
• Oxprenolol Action Pathway
• Penbutolol Action Pathway
• Phenytoin (Antiarrhythmic) Action Pathway
• Pindolol Action Pathway
• Practolol Action Pathway
• Procainamide (Antiarrhythmic) Action Pathway
• Propranolol Action Pathway
• Quinidine Action Pathway
• Sotalol Action Pathway
• Timolol Action Pathway
• Tocainide Action Pathway
• Verapamil Action Pathway

>483 bp
ATGACGGACCAGCAGGCTGAGGCCAGGTCCTACCTCAGCGAAGAGATGATCGCTGAGTTC
AAGGCTGCCTTTGACATGTTTGATGCTGATGGTGGTGGGGACATCAGCGTCAAGGAGTTG
GGCACGGTGATGAGGATGCTGGGCCAGACACCCACCAAGGAGGAGCTGGACGCCATCATC
GAGGAGGTGGATGAGGACGGCAGCGGCACCATCGACTTCGAGGAGTTCTTGGTCATGATG
GTGCGCCAGATGAAAGAGGACGCGAAAGGGAAGAGCGAGGAGGAGCTGGCCGAGTGCTTC
CGCATCTTCGACAGGAATGCAGACGGCTACATCGACCCGGAGGAGCTGGCTGAGATTTTC
AGGGCCTCCGGGGAGCACGTGACGGACGAGGAGATCGAATCTCTGATGAAAGACGGCGAC
AAGAACAACGACGGCCGCATTGACTTCGACGAGTTCCTGAAGATGATGGAGGGCGTGCAG
TAA

• efhand (PF00036 )

• None

• None

>Troponin C, skeletal muscle
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

• 1A2X

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
3. Gahlmann R, Wade R, Gunning P, Kedes L: Differential expression of slow and fast skeletal muscle troponin C. Slow skeletal muscle troponin C is expressed in human fibroblasts. J Mol Biol. 1988 May 20;201(2):379-91. [PubMed:3166492 ]
4. Gahlmann R, Kedes L: Cloning, structural analysis, and expression of the human fast twitch skeletal muscle troponin C gene. J Biol Chem. 1990 Jul 25;265(21):12520-8. [PubMed:2373703 ]
5. Romero-Herrera AE, Castillo O, Lehmann H: Human skeletal muscle proteins. The primary structure of troponin C. J Mol Evol. 1976 Oct 27;8(3):251-70. [PubMed:978749 ]