You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08078
Secondary Accession Numbers
  • 13789
Name Short transient receptor potential channel 6
Synonyms
  1. TRP-6
  2. Transient receptor protein 6
  3. TrpC6
Gene Name TRPC6
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C. Seems not to be activated by intracellular calcium store depletion
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 11q22.1
SNPs TRPC6
Gene Sequence
>2796 bp
ATGAGCCAGAGCCCGGCGTTCGGGCCCCGGAGGGGCAGTTCTCCCCGGGGCGCTGCCGGA
GCCGCTGCGCGGCGCAACGAGAGCCAGGACTATCTGCTCATGGACTCGGAGCTGGGAGAA
GACGGCTGCCCGCAAGCCCCGCTGCCTTGCTACGGCTACTACCCCTGCTTCCGGGGATCT
GACAACAGACTGGCTCACCGGCGGCAGACAGTTCTCCGTGAGAAGGGGAGAAGGTTAGCT
AATCGAGGACCAGCATACATGTTTAGTGATCGCTCCACAAGCCTATCTATAGAGGAGGAA
CGCTTTTTGGATGCAGCTGAATATGGTAACATCCCAGTGGTGCGGAAGATGTTAGAAGAA
TGCCACTCACTCAACGTTAACTGTGTGGATTACATGGGCCAGAATGCCCTACAGTTGGCA
GTGGCCAATGAGCATCTGGAAATTACAGAACTTCTTCTCAAGAAAGAAAACCTCTCTCGA
GTTGGGGATGCTTTGCTTCTAGCTATTAGTAAAGGTTATGTTCGGATTGTGGAAGCAATT
CTCAGTCATCCGGCTTTTGCTGAAGGCAAGAGGTTAGCAACCAGCCCTAGCCAGTCTGAA
CTCCAGCAAGATGATTTTTATGCCTATGATGAAGATGGGACACGGTTCTCCCATGATGTG
ACTCCAATCATTCTGGCTGCCCACTGCCAGGAATATGAAATTGTGCATACCCTCCTGCGG
AAGGGTGCTAGGATTGAACGGCCTCATGATTATTTCTGCAAGTGCAATGACTGCAACCAG
AAACAGAAGCATGACTCGTTTAGCCACTCCAGATCTAGGATTAATGCCTATAAAGGCCTG
GCAAGTCCGGCTTACCTGTCATTGTCTAGTGAAGATCCAGTCATGACGGCTTTAGAACTT
AGCAATGAACTGGCAGTTCTGGCCAATATTGAGAAAGAGTTCAAGAATGACTACAAAAAA
CTGTCAATGCAGTGCAAAGACTTTGTTGTTGGACTCCTTGATCTGTGCAGAAACACTGAA
GAAGTCGAGGCCATTCTGAATGGGGATGTTGAAACGCTCCAGAGTGGTGATCACGGTCGC
CCAAATCTCAGCCGTTTAAAACTTGCCATTAAATATGAAGTAAAAAAATTTGTAGCTCAT
CCAAACTGCCAACAGCAACTTCTCTCCATTTGGTATGAGAATCTTTCTGGTTTACGACAG
CAGACAATGGCGGTCAAGTTCCTTGTGGTCCTTGCTGTTGCCATTGGACTGCCCTTCCTG
GCTCTCATTTACTGGTTTGCTCCATGCAGCAAGATGGGGAAGATAATGCGTGGACCATTC
ATGAAGTTTGTAGCACACGCAGCCTCCTTCACCATTTTTCTGGGACTGCTAGTCATGAAT
GCAGCTGACAGATTTGAAGGCACAAAACTCCTTCCTAATGAAACCAGCACAGATAATGCA
AAACAGCTGTTCAGGATGAAAACATCCTGCTTCTCATGGATGGAGATGCTCATTATATCC
TGGGTAATAGGCATGATATGGGCTGAATGTAAAGAAATCTGGACTCAGGGCCCCAAGGAA
TATTTGTTTGAGTTGTGGAACATGCTTGATTTTGGTATGTTAGCAATTTTCGCAGCATCA
TTCATTGCGAGATTCATGGCATTTTGGCATGCTTCCAAAGCCCAGAGCATCATTGACGCA
AACGATACTTTGAAGGACTTGACGAAAGTAACATTGGGAGACAATGTGAAATACTACAAT
TTGGCCAGGATAAAGTGGGACCCCTCTGATCCTCAAATAATATCTGAAGGTCTTTATGCA
ATTGCTGTAGTTTTAAGTTTCTCTAGGATAGCTTATATTTTACCAGCAAATGAAAGCTTT
GGACCTCTGCAGATATCACTTGGAAGAACAGTCAAAGACATCTTCAAGTTCATGGTCATA
TTCATTATGGTGTTTGTGGCCTTTATGATTGGAATGTTCAATCTCTACTCCTACTACATT
GGTGCAAAACAAAATGAAGCCTTCACAACAGTTGAAGAGAGTTTTAAGACACTGTTCTGG
GCTATATTTGGACTTTCTGAAGTGAAATCAGTGGTCATCAACTATAACCACAAATTCATT
GAAAACATTGGTTACGTTCTTTATGGAGTCTATAATGTTACGATGGTCATTGTTTTGCTA
AATATGTTAATTGCCATGATCAACAGTTCATTCCAGGAAATTGAGGATGACGCTGATGTG
GAGTGGAAATTTGCAAGGGCCAAACTCTGGTTTTCCTACTTTGAGGAGGGCAGAACACTT
CCTGTACCCTTCAATCTGGTGCCGAGTCCAAAGTCCCTGTTTTATCTCTTACTGAAGCTT
AAAAAATGGATTTCTGAGCTGTTCCAGGGCCATAAAAAAGGTTTCCAGGAAGATGCAGAG
ATGAACAAGATAAATGAAGAAAAGAAACTTGGAATTTTAGGAAGTCATGAAGACCTTTCA
AAATTATCACTTGACAAAAAACAGGTTGGGCACAATAAACAACCAAGTATAAGGAGCTCA
GAAGATTTCCATCTAAATAGTTTCAATAATCCTCCAAGACAATATCAGAAAATAATGAAA
AGGCTCATTAAAAGATATGTACTGCAGGCCCAGATAGATAAGGAGAGTGATGAAGTGAAC
GAAGGGGAACTGAAGGAAATTAAGCAGGACATCTCAAGTCTCCGCTATGAACTCCTTGAA
GAAAAATCTCAGAATACAGAAGACCTAGCAGAACTTATTAGAGAACTTGGAGAGAAATTA
TCCATGGAACCAAATCAAGAGGAAACCAATAGATAA
Protein Properties
Number of Residues 931
Molecular Weight 106325.3
Theoretical pI 6.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 439-459
  • 488-508
  • 522-542
  • 593-613
  • 637-657
  • 707-727
Protein Sequence
>Short transient receptor potential channel 6
MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGS
DNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEE
CHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAI
LSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLR
KGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALEL
SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGR
PNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL
ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNA
KQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAAS
FIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA
IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYI
GAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLL
NMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKL
KKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS
EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLE
EKSQNTEDLAELIRELGEKLSMEPNQEETNR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y210
UniProtKB/Swiss-Prot Entry Name TRPC6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF080394
GeneCard ID TRPC6
GenAtlas ID TRPC6
HGNC ID HGNC:12338
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  4. Hofmann T, Obukhov AG, Schaefer M, Harteneck C, Gudermann T, Schultz G: Direct activation of human TRPC6 and TRPC3 channels by diacylglycerol. Nature. 1999 Jan 21;397(6716):259-63. [PubMed:9930701 ]
  5. Lussier MP, Cayouette S, Lepage PK, Bernier CL, Francoeur N, St-Hilaire M, Pinard M, Boulay G: MxA, a member of the dynamin superfamily, interacts with the ankyrin-like repeat domain of TRPC. J Biol Chem. 2005 May 13;280(19):19393-400. Epub 2005 Mar 9. [PubMed:15757897 ]
  6. Lussier MP, Lepage PK, Bousquet SM, Boulay G: RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC. Cell Calcium. 2008 May;43(5):432-43. Epub 2007 Sep 11. [PubMed:17850865 ]
  7. D'Esposito M, Strazzullo M, Cuccurese M, Spalluto C, Rocchi M, D'Urso M, Ciccodicola A: Identification and assignment of the human transient receptor potential channel 6 gene TRPC6 to chromosome 11q21-->q22. Cytogenet Cell Genet. 1998;83(1-2):46-7. [PubMed:9925922 ]
  8. Philipp S, Trost C, Warnat J, Rautmann J, Himmerkus N, Schroth G, Kretz O, Nastainczyk W, Cavalie A, Hoth M, Flockerzi V: TRP4 (CCE1) protein is part of native calcium release-activated Ca2+-like channels in adrenal cells. J Biol Chem. 2000 Aug 4;275(31):23965-72. [PubMed:10816590 ]
  9. Reiser J, Polu KR, Moller CC, Kenlan P, Altintas MM, Wei C, Faul C, Herbert S, Villegas I, Avila-Casado C, McGee M, Sugimoto H, Brown D, Kalluri R, Mundel P, Smith PL, Clapham DE, Pollak MR: TRPC6 is a glomerular slit diaphragm-associated channel required for normal renal function. Nat Genet. 2005 Jul;37(7):739-44. Epub 2005 May 27. [PubMed:15924139 ]
  10. Winn MP, Conlon PJ, Lynn KL, Farrington MK, Creazzo T, Hawkins AF, Daskalakis N, Kwan SY, Ebersviller S, Burchette JL, Pericak-Vance MA, Howell DN, Vance JM, Rosenberg PB: A mutation in the TRPC6 cation channel causes familial focal segmental glomerulosclerosis. Science. 2005 Jun 17;308(5729):1801-4. Epub 2005 May 5. [PubMed:15879175 ]