You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08079
Secondary Accession Numbers
  • 13790
Name Short transient receptor potential channel 7
Synonyms
  1. TRP-7
  2. Transient receptor protein 7
  3. TrpC7
  4. hTRP7
Gene Name TRPC7
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG). May also be activated by intracellular calcium store depletion
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs TRPC7
Gene Sequence
>2589 bp
ATGTTGAGGAACAGCACCTTCAAAAACATGCAGCGCCGGCACACAACGCTGAGGGAGAAG
GGCCGTCGCCAGGCCATCCGGGGTCCCGCCTACATGTTCAACGAGAAGGGCACCAGTCTG
ACGCCCGAGGAGGAGCGCTTCCTGGACTCGGCTGAGTATGGCAACATCCCGGTGGTCCGG
AAAATGCTGGAGGAGTCCAAGACCCTTAACTTCAACTGTGTGGACTACATGGGGCAGAAC
GCTCTGCAGCTGGCCGTGGGCAACGAGCACCTAGAGGTCACGGAGCTGCTGCTGAAGAAG
GAGAACCTGGCACGGGTGGGGGACGCGCTGCTGCTGGCCATCAGCAAGGGCTATGTGCGC
ATCGTGGAGGCCATCCTCAACCACCCGGCCTTCGCGCAGGGCCAGCGCCTGACGCTCAGC
CCGCTGGAACAGGAGCTGCGCGACGACGACTTCTATGCCTACGACGAGGACGGCACGCGC
TTCTCCCACGACATCACGCCCATCATCCTGGCGGCGCACTGCCAGGAGTATGAGATCGTG
CACATCCTGCTGCTCAAGGGCGCCCGCATCGAGCGGCCCCACGACTACTTCTGCAAGTGC
AATGAGTGCACCGAGAAACAGCGGAAAGACTCCTTCAGCCACTCGCGCTCGCGCATGAAC
GCCTACAAAGGACTGGCGAGTGCTGCCTACTTGTCCCTGTCCAGCGAAGACCCTGTCCTC
ACCGCCCTGGAGCTCAGCAACGAGTTAGCCAGACTAGCCAACATTGAGACTGAATTTAAG
AACGATTACAGGAAGTTATCTATGCAATGCAAGGATTTTGTAGTGGGCGTGCTGGACCTG
TGCCGAGACACAGAAGAGGTGGAAGCAATTTTAAACGGTGATGTGAACTTCCAAGTCTGG
TCCGACCACCACCGTCCAAGTCTGAGCCGGATCAAACTCGCCATTAAATATGAAGTCAAG
AAGTTCGTTGCTCATCCTAACTGTCAGCAGCAATTGCTTACCATGTGGTATGAAAATCTC
TCAGGCTTACGTCAACAGTCTATCGCTGTGAAATTCCTGGCTGTCTTTGGAGTCTCCATA
GGCCTCCCTTTTCTCGCCATAGCCTATTGGATTGCTCCGTGCAGCAAGCTAGGACGAACC
CTGAGGAGCCCTTTCATGAAGTTTGTAGCTCATGCAGTTTCTTTTACAATCTTCTTGGGA
TTATTAGTTGTGAATGCATCTGACCGATTTGAAGGTGTTAAAACCCTGCCAAACGAAACC
TTCACAGACTACCCAAAACAAATCTTCAGAGTGAAAACCACACAGTTCTCCTGGACAGAA
ATGCTCATTATGAAGTGGGTCTTAGGAATGATTTGGTCCGAATGCAAGGAAATCTGGGAG
GAGGGGCCACGGGAGTACGTGCTGCACTTGTGGAACCTGCTAGATTTCGGGATGCTGTCC
ATCTTCGTGGCCTCCTTCACAGCACGCTTCATGGCCTTCCTGAAGGCCACGGAGGCACAG
CTGTACGTGGACCAGCACGTGCAGGACGACACGCTGCACAATGTCTCGCTTCCGCCGGAA
GTGGCATACTTCACCTACGCCAGGGACAAGTGGTGGCCTTCAGACCCTCAGATCATATCG
GAAGGGCTCTACGCGATAGCCGTCGTGCTGAGCTTCTCTCGCATTGCATACATTCTGCCA
GCCAACGAGAGTTTTGGGCCCCTGCAGATCTCGCTAGGGAGAACTGTGAAAGATATCTTC
AAGTTCATGGTCATTTTCATCATGGTATTTGTGGCCTTCATGATTGGGATGTTCAACCTG
TACTCTTACTACCGAGGTGCCAAATACAACCCAGCGTTTACAACGGTTGAAGAAAGTTTT
AAAACTTTGTTTTGGTCCATATTCGGCTTATCTGAAGTAATCTCAGTGGTGCTGAAATAC
GACCACAAATTCATCGAGAACATTGGCTACGTTCTCTACGGCGTTTATAACGTCACCATG
GTGGTAGTGTTGCTCAACATGCTAATAGCCATGATAAACAACTCCTATCAGGAAATTGAG
GAGGATGCAGATGTGGAATGGAAGTTCGCCCGAGCAAAACTCTGGCTGTCTTACTTTGAT
GAAGGAAGAACTCTACCTGCTCCTTTTAATCTAGTGCCAAGTCCTAAATCATTTTATTAT
CTCATAATGAGAATCAAGATGTGCCTCATAAAACTCTGCAAATCTAAGGCCAAAAGCTGT
GAAAATGACCTTGAAATGGGCATGCTGAATTCCAAATTCAAGAAGACTCGCTACCAGGCT
GGCATGAGGAATTCTGAAAATCTGACAGCAAATAACACTTTGAGCAAGCCCACCAGATAC
CAGAAAATCATGAAACGGCTCATAAAAAGATACGTCCTGAAAGCCCAGGTGGACAGAGAA
AATGACGAAGTCAATGAAGGCGAGCTGAAGGAAATCAAGCAAGATATCTCCAGCCTGCGC
TATGAGCTTCTTGAGGAAAAATCTCAAGCTACTGGTGAGCTGGCAGACCTGATTCAACAA
CTCAGCGAGAAGTTTGGAAAGAACTTAAACAAAGACCACCTGAGGGTGAACAAGGGCAAA
GACATTTAG
Protein Properties
Number of Residues 862
Molecular Weight 99561.3
Theoretical pI 7.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 352-372
  • 384-404
  • 466-486
  • 538-558
  • 582-602
  • 652-672
Protein Sequence
>Short transient receptor potential channel 7
MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVR
KMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVR
IVEAILNHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIV
HILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVL
TALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNFQVW
SDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSI
GLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNET
FTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLS
IFVASFTARFMAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIIS
EGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNL
YSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTM
VVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYY
LIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
QKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQ
LSEKFGKNLNKDHLRVNKGKDI
GenBank ID Protein 9798452
UniProtKB/Swiss-Prot ID Q9HCX4
UniProtKB/Swiss-Prot Entry Name TRPC7_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ272034
GeneCard ID TRPC7
GenAtlas ID TRPC7
HGNC ID HGNC:20754
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Lussier MP, Cayouette S, Lepage PK, Bernier CL, Francoeur N, St-Hilaire M, Pinard M, Boulay G: MxA, a member of the dynamin superfamily, interacts with the ankyrin-like repeat domain of TRPC. J Biol Chem. 2005 May 13;280(19):19393-400. Epub 2005 Mar 9. [PubMed:15757897 ]
  3. Lussier MP, Lepage PK, Bousquet SM, Boulay G: RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC. Cell Calcium. 2008 May;43(5):432-43. Epub 2007 Sep 11. [PubMed:17850865 ]