You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08100
Secondary Accession Numbers
  • 13811
Name Villin-1
Synonyms Not Available
Gene Name VIL1
Protein Type Unknown
Biological Properties
General Function Involved in actin binding
Specific Function Ca(2+)-regulated actin-binding protein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
cytoskeletal protein binding
actin binding
Process
cytoskeleton organization
cellular process
cellular component organization at cellular level
organelle organization
Cellular Location
  1. Cytoplasm
  2. cytoskeleton
Gene Properties
Chromosome Location Chromosome:2
Locus 2q35
SNPs VIL1
Gene Sequence
>2484 bp
ATGACCAAGCTGAGCGCCCAAGTCAAAGGCTCTCTCAACATCACCACCCCGGGGCTGCAG
ATATGGAGGATCGAGGCCATGCAGATGGTGCCTGTTCCTTCCAGCACCTTTGGAAGCTTC
TTCGATGGTGACTGCTACATCATCCTGGCTATCCACAAGACAGCCAGCAGCCTGTCCTAT
GACATCCACTACTGGATTGGCCAGGACTCATCCCTGGATGAGCAGGGGGCAGCTGCCATC
TACACCACACAGATGGATGACTTCCTGAAGGGCCGGGCTGTGCAGCACCGCGAGGTCCAG
GGCAACGAGAGCGAGGCCTTCCGAGGCTACTTCAAGCAAGGCCTTGTGATCCGGAAAGGG
GGCGTGGCTTCTGGCATGAAGCACGTGGAGACCAACTCCTATGACGTCCAGAGGCTGCTG
CATGTCAAGGGCAAGAGGAACGTGGTAGCTGGAGAGGTAGAGATGTCCTGGAAGAGTTTC
AACCGAGGGGATGTTTTCCTCCTGGACCTTGGGAAGCTTATCATCCAGTGGAATGGACCG
GAAAGCACCCGTATGGAGAGACTCAGGGGCATGACTCTGGCCAAGGAGATCCGAGACCAG
GAGCGGGGAGGGCGCACCTATGTAGGCGTGGTGGACGGAGAGAATGAATTGGCATCCCCG
AAGCTGATGGAGGTGATGAACCACGTGCTGGGCAAGCGCAGGGAGCTGAAGGCGGCCGTG
CCCGACACGGTGGTGGAGCCGGCACTCAAGGCTGCACTCAAACTGTACCATGTGTCTGAC
TCCGAGGGGAATCTGGTGGTGAGGGAAGTCGCCACACGGCCACTGACACAGGACCTGCTC
AGTCACGAGGACTGTTACATCCTGGACCAGGGGGGCCTGAAGATCTACGTGTGGAAAGGG
AAGAAAGCCAATGAGCAGGAGAAGAAGGGAGCCATGAGCCATGCGCTGAACTTCATCAAA
GCCAAGCAGTACCCACCAAGCACACAGGTGGAGGTGCAGAATGATGGGGCTGAGTCGGCC
GTCTTTCAGCAGCTCTTCCAGAAGTGGACAGCGTCCAACCGGACCTCAGGCCTAGGCAAA
ACCCACACTGTGGGCTCCGTGGCCAAAGTGGAACAGGTGAAGTTCGATGCCACATCCATG
CATGTCAAGCCTCAGGTGGCTGCCCAGCAGAAGATGGTAGATGATGGGAGTGGGGAAGTG
CAGGTGTGGCGCATTGAGAACCTAGAGCTGGTACCTGTGGATTCCAAGTGGCTAGGCCAC
TTCTATGGGGGCGACTGCTACCTGCTGCTCTACACCTACCTCATCGGCGAGAAGCAGCAT
TACCTGCTCTACGTTTGGCAGGGCAGCCAGGCCAGCCAAGATGAAATTACAGCATCAGCT
TATCAAGCCGTCATCCTGGACCAGAAGTACAATGGTGAACCAGTCCAGATCCGGGTCCCA
ATGGGCAAGGAGCCACCTCATCTTATGTCCATCTTCAAGGGACGCATGGTGGTCTACCAG
GGAGGCACCTCCCGAACTAACAACTTGGAGACCGGGCCCTCCACACGGCTGTTCCAGGTC
CAGGGAACTGGCGCCAACAACACCAAGGCCTTTGAGGTCCCAGCGCGGGCCAATTTCCTC
AATTCCAATGATGTCTTTGTCCTCAAGACCCAGTCTTGCTGCTATCTATGGTGTGGGAAG
GGTTGTAGCGGGGACGAGCGGGAGATGGCCAAGATGGTTGCTGACACCATCTCCCGGACG
GAGAAGCAAGTGGTGGTGGAAGGGCAGGAGCCAGCCAACTTCTGGATGGCCCTGGGTGGG
AAGGCCCCCTATGCCAACACCAAGAGACTACAGGAAGAAAACCTGGTCATCACCCCCCGG
CTCTTTGAGTGTTCCAACAAGACTGGGCGCTTCCTGGCCACAGAGATCCCTGACTTCAAT
CAGGATGACTTGGAAGAGGATGATGTGTTCCTACTAGATGTCTGGGACCAGGTCTTCTTC
TGGATTGGGAAACATGCCAACGAGGAGGAGAAGAAGGCCGCAGCAACCACTGCACAGGAA
TACCTCAAGACCCATCCCAGCGGGCGTGACCCTGAGACCCCCATCATTGTGGTGAAGCAG
GGACACGAGCCCCCCACCTTCACAGGCTGGTTCCTGGCTTGGGATCCCTTCAAGTGGAGT
AACACCAAATCCTATGAGGACCTGAAGGCGGAGCTTGGCAACTCTAGGGACTGGAGCCAG
ATCACTGCTGAGGTCACAAGCCCCAAAGTGGACGTGTTCAATGCTAACAGCAACCTCAGT
TCTGGGCCTCTGCCCATCTTCCCCCTGGAGCAGCTAGTGAACAAGCCTGTAGAGGAGCTC
CCCGAGGGTGTGGACCCCAGCAGGAAGGAGGAACACCTGTCCATTGAAGATTTCACTCAG
GCCTTTGGGATGACTCCAGCTGCCTTCTCTGCTCTGCCTCGATGGAAGCAACAAAACCTC
AAGAAAGAAAAAGGACTATTTTGA
Protein Properties
Number of Residues 827
Molecular Weight 92694.6
Theoretical pI 6.35
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Villin-1
MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSY
DIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKG
GVASGMKHVETNSYDVQRLLHVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGP
ESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAV
PDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKG
KKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTASNRTSGLGK
THTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH
FYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVP
MGKEPPHLMSIFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFL
NSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGG
KAPYANTKRLQEENLVITPRLFECSNKTGRFLATEIPDFNQDDLEEDDVFLLDVWDQVFF
WIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQGHEPPTFTGWFLAWDPFKWS
NTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLEQLVNKPVEEL
PEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLF
GenBank ID Protein 194394237
UniProtKB/Swiss-Prot ID P09327
UniProtKB/Swiss-Prot Entry Name VILI_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_007127.2
GeneCard ID VIL1
GenAtlas ID VIL1
HGNC ID HGNC:12690
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Arpin M, Pringault E, Finidori J, Garcia A, Jeltsch JM, Vandekerckhove J, Louvard D: Sequence of human villin: a large duplicated domain homologous with other actin-severing proteins and a unique small carboxy-terminal domain related to villin specificity. J Cell Biol. 1988 Nov;107(5):1759-66. [PubMed:2846586 ]
  4. Pringault E, Arpin M, Garcia A, Finidori J, Louvard D: A human villin cDNA clone to investigate the differentiation of intestinal and kidney cells in vivo and in culture. EMBO J. 1986 Dec 1;5(12):3119-24. [PubMed:3453110 ]