You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08107
Secondary Accession Numbers
  • 13818
Name A-kinase anchor protein 2
Synonyms
  1. AKAP-2
  2. AKAP-KL
  3. PRKA2
  4. Protein kinase A-anchoring protein 2
Gene Name AKAP2
Protein Type Unknown
Biological Properties
General Function Involved in enzyme binding
Specific Function Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:9
Locus 9q31.3
SNPs AKAP2
Gene Sequence
>2580 bp
ATGGAAATTGAGGTGTCTGTTGCAGAATGTAAAAGTGTTCCTGGAATCACCTCTACCCCA
CATCCCATGGACCATCCCTCCGCTTTCTATTCACCCCCGCATAATGGCCTCCTTACTGAT
CACCACGAATCCCTGGATAATGATGTTGCCAGAGAGATCCGCTATCTAGATGAGGTGCTA
GAGGCCAACTGCTGTGATTCTGCTGTGGATGGAACGTACAATGGAACATCCTCCCCAGAG
CCTGGTGCAGTGGTTCTGGTGGGCGGCCTAAGCCCCCCTGTCCACGAGGCGACCCAGCCA
GAACCCACTGAAAGAACAGCTAGCCGGCAGGCACCTCCTCACATCGAGCTCAGTAATAGC
AGCCCTGACCCCATGGCAGAGGCAGAAAGAACAAATGGCCATTCCCCCAGCCAGCCTAGA
GATGCGCTGGGGGACAGCCTGCAGGTGCCTGTCAGCCCCAGCTCCACAACCAGCTCACGG
TGTTCTTCCCGAGATGGAGAGTTCACTCTCACCACACTGAAAAAGGAGGCCAAGTTTGAG
CTGCGTGCCTTCCATGAGGACAAGAAGCCCTCCAAGCTCTTTGAGGATGACGAGCATGAG
AAAGAACAATACTGCATTAGAAAAGTGAGGCCTTCAGAGGAGATGCTGGAGCTGGAAAAG
GAGAGGAGAGAGCTCATCCGCAGCCAGGCCGTCAAGAAGAATCCTGGCATTGCAGCAAAA
TGGTGGAATCCCCCGCAGGAAAAAACCATCGAGGAGCAGCTGGACGAGGAACATCTGGAG
TCGCACAAAAAGTACAAGGAGCGCAAAGAGAGAAGGGCACAGCAGGAACAGTTGCTGCTG
CAGCAGCAGTTACAGCAGCAGCAGCAGCAGCCCCCATCGCAGCTCTGCACAGCCCCTGCC
TCTTCTCATGAACGCGCAAGCATGATTGACAAAGCAAAGGAGGACATTGTCACAGAGCAG
ATAGATTTCTCTGCTGCTCGCAAACAATTTCAGCTGATGGAGAATTCCAGGCAAGCGGTG
GCCAAGGGCCAGAGTACACCCAGGCTGTTCTCCATCAAGCCTTTCTACAGGCCTCTGGGG
TCAGTCAACTCAGACAAGCCACTGACTAATCCGAGACCACCTTCTGTCGGGGGACCTCCA
GAAGACAGTGGTGCCTCAGCCGCCAAGGGACAGAAATCCCCCGGTGCCCTGGAGACCCCA
TCGGCAGCAGGAAGCCAGGGCAACACAGCCTCTCAGGGGAAGGAAGGGCCCTACAGCGAG
CCTTCTAAACGTGGGCCCTTATCTAAACTGTGGGCTGAGGATGGAGAATTTACGAGCGCC
CGGGCTGTCCTCACTGTGGTCAAGGATGATGACCATGGGATTTTGGATCAGTTCTCAAGA
TCTGTCAATGTCTCCTTGACCCAAGAGGAGCTTGACTCTGGTCTGGACGAATTGTCGGTG
AGGTCTCAGGATACCACAGTCCTGGAGACCCTATCCAATGATTTCAGCATGGACAACATC
AGTGACAGCGGGGCATCCAATGAGACAACCAATGCCCTCCAGGAAAATTCACTGGCTGAT
TTTTCTCTGCCCCAGACACCACAAACTGACAACCCCTCAGAGGGCCGAGGAGAAGGCGTC
TCCAAGTCATTTAGTGATCATGGTTTCTATTCCCCTTCCTCCACGCTGGGGGACTCTCCG
TTGGTTGATGACCCCTTGGAGTATCAGGCTGGCCTCCTGGTGCAGAATGCCATTCAACAA
GCCATAGCCGAGCAGGTGGATAAAGCTGTGTCCAAAACCAGCAGGGATGGAGCAGAGCAA
CAGGGACCTGAAGCGACTGTAGAGGAAGCTGAAGCTGCGGCTTTCGGCTCAGAAAAGCCT
CAGAGCATGTTTGAGCCACCTCAGGTGTCTTCTCCTGTTCAAGAGAAAAGGGATGTATTA
CCAAAGATTCTGCCTGCTGAAGACAGGGCGCTCAGGGAAAGGGGGCCCCCCCAGCCACTG
CCAGCTGTGCAGCCCAGTGGCCCGATTAACATGGAGGAGACCAGGCCCGAAGGAAGCTAT
TTCAGCAAGTACTCGGAGGCAGCTGAGCTGAGAAGCACAGCCTCCCTCCTGGCCACTCAA
GAATCTGACGTGATGGTTGGGCCTTTCAAGCTGAGGTCCAGGAAACAGCGGACTTTGTCC
ATGATTGAGGAAGAGATCCGAGCAGCTCAGGAAAGGGAAGAGGAGCTGAAGAGGCAGAGA
CAAGTCTTGCAGAGTACGCAGAGCCCCAGGACAAAGAATGCCCCATCGCTGCCCTCCAGA
ACATGCTACAAAACTGCTCCAGGGAAAATAGAGAAAGTCAAACCTCCTCCATCCCCCACC
ACTGAAGGCCCCAGCTTGCAGCCTGACTTAGCCCCTGAAGAGGCTGCCGGAACCCAGCGG
CCCAAGAATCTGATGCAGACCCTCATGGAAGACTATGAGACACACAAATCTAAAAGGCGC
GAGAGAATGGATGATAGTAGTGTCCTCGAGGCCACACGGGTTAATCGAAGAAAGAGCGCA
CTGGCTTTGCGCTGGGAAGCAGGGATCTATGCCAACCAGGAGGAAGAAGACAACGAATAA
Protein Properties
Number of Residues 859
Molecular Weight 94659.7
Theoretical pI 4.76
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>A-kinase anchor protein 2
MEIEVSVAECKSVPGITSTPHPMDHPSAFYSPPHNGLLTDHHESLDNDVAREIRYLDEVL
EANCCDSAVDGTYNGTSSPEPGAVVLVGGLSPPVHEATQPEPTERTASRQAPPHIELSNS
SPDPMAEAERTNGHSPSQPRDALGDSLQVPVSPSSTTSSRCSSRDGEFTLTTLKKEAKFE
LRAFHEDKKPSKLFEDDEHEKEQYCIRKVRPSEEMLELEKERRELIRSQAVKKNPGIAAK
WWNPPQEKTIEEQLDEEHLESHKKYKERKERRAQQEQLLLQKQLQQQQQQPPSQLCTAPA
SSHERASMIDKAKEDIVTEQIDFSAARKQFQLMENSRQAVAKGQSTPRLFSIKPFYRPLG
SVNSDKPLTNPRPPSVGGPPEDSGASAAKGQKSPGALETPSAAGSQGNTASQGKEGPYSE
PSKRGPLSKLWAEDGEFTSARAVLTVVKDDDHGILDQFSRSVNVSLTQEELDSGLDELSV
RSQDTTVLETLSNDFSMDNISDSGASNETTNALQENSLADFSLPQTPQTDNPSEGRGEGV
SKSFSDHGFYSPSSTLGDSPLVDDPLEYQAGLLVQNAIQQAIAEQVDKAVSKTSRDGAEQ
QGPEATVEEAEAAAFGSEKPQSMFEPPQVSSPVQEKRDVLPKILPAEDRALRERGPPQPL
PAVQPSGPINMEETRPEGSYFSKYSEAAELRSTASLLATQESDVMVGPFKLRSRKQRTLS
MIEEEIRAAQEREEELKRQRQVLQSTQSPRTKNAPSLPSRTCYKTAPGKIEKVKPPPSPT
TEGPSLQPDLAPEEAAGTQRPKNLMQTLMEDYETHKSKRRERMDDSSVLEATRVNRRKSA
LALRWEAGIYANQEEEDNE
GenBank ID Protein 194390790
UniProtKB/Swiss-Prot ID Q9Y2D5
UniProtKB/Swiss-Prot Entry Name AKAP2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK300427
GeneCard ID AKAP2
GenAtlas ID AKAP2
HGNC ID HGNC:372
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  9. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  10. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  11. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]
  12. Hu B, Copeland NG, Gilbert DJ, Jenkins NA, Kilimann MW: The paralemmin protein family: identification of paralemmin-2, an isoform differentially spliced to AKAP2/AKAP-KL, and of palmdelphin, a more distant cytosolic relative. Biochem Biophys Res Commun. 2001 Aug 3;285(5):1369-76. [PubMed:11478809 ]