You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08108
Secondary Accession Numbers
  • 13819
Name A-kinase anchor protein 5
Synonyms
  1. A-kinase anchor protein 79 kDa
  2. AKAP 79
  3. AKAP-5
  4. H21
  5. cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein
Gene Name AKAP5
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Process
establishment of localization
transport
protein transport
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular protein transport
protein targeting
Cellular Location
  1. Membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 14q21-q24
SNPs AKAP5
Gene Sequence
>1284 bp
ATGGAAACCACAATTTCAGAAATTCATGTAGAAAACAAGGATGAGAAGAGATCAGCAGAA
GGTAGTCCTGGGGCTGAAAGGCAGAAGGAAAAGGCATCCATGCTTTGCTTCAAGAGAAGA
AAGAAAGCAGCCAAAGCACTGAAGCCCAAAGCTGGCTCTGAAGCTGCTGATGTGGCAAGG
AAGTGTCCACAAGAAGCAGGAGCTTCTGATCAGCCAGAGCCCACACGGGGGGCCTGGGCC
TCACTCAAACGTCTTGTAACACGCAGGAAAAGGTCAGAGTCTTCAAAGCAGCAAAAGCCA
TTGGAGGGTGAAATGCAACCTGCAATAAATGCTGAGGATGCTGATCTTTCTAAGAAAAAG
GCAAAATCTAGACTTAAGATTCCCTGCATAAAATTCCCAAGAGGGCCAAAAAGGAGTAAT
CATTCCAAAATTATAGAAGACTCAGACTGCAGCATCAAAGTCCAGGAAGAAGCTGAAATT
TTGGATATACAAACACAGACCCCATTGAATGATCAGGCAACAAAGGCTAAGTCAACCCAG
GATCTAAGTGAAGGCATCTCACGGAAAGATGGTGATGAGGTCTGTGAATCAAATGTGAGC
AATAGCACAACTTCTGGAGAGAAAGTGATTTCAGTAGAACTTGGATTAGATAATGGGCAT
TCTGCTATTCAAACGGGAACTCTAATCCTTGAAGAAATTGAAACGATCAAGGAAAAACAA
GATGTTCAACCCCAGCAAGCAAGCCCACTTGAAACTTCAGAAACAGACCATCAGCAGCCA
GTACTTTCTGATGTTCCTCCTTTACCTGCAATTCCAGATCAACAAATTGTGGAAGAAGCC
AGTAACAGTACCCTAGAAAGTGCACCAAATGGAAAAGACTATGAAAGTACAGAGATTGTA
GCTGAAGAAACTAAGCCAAAAGATACTGAATTGAGCCAAGAATCAGATTTTAAAGAAAAT
GGGATCACTGAAGAGAAATCCAAATCAGAAGAAAGCAAAAGAATGGAGCCAATTGCTATT
ATTATTACAGACACTGAAATCAGTGAATTTGATGTTACAAAATCTAAAAATGTCCCTAAG
CAATTCTTAATTTCAGCTGAAAATGAGCAAGTAGGGGTTTTTGCTAATGATAATGGTTTT
GAGGATAGAACTTCAGAACAATATGAAACACTCTTAATTGAAACAGCCTCTTCTCTAGTC
AAGAATGCTATTCAGTTGTCAATAGAACAGCTGGTTAATGAAATGGCCTCTGATGATAAT
AAAATAAACAATCTTCTACAGTGA
Protein Properties
Number of Residues 427
Molecular Weight 47087.8
Theoretical pI 4.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>A-kinase anchor protein 5
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQ
DVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIV
AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPK
QFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
GenBank ID Protein 158187521
UniProtKB/Swiss-Prot ID P24588
UniProtKB/Swiss-Prot Entry Name AKAP5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004857.3
GeneCard ID AKAP5
GenAtlas ID AKAP5
HGNC ID HGNC:375
References
General References
  1. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  2. Carr DW, Stofko-Hahn RE, Fraser ID, Cone RD, Scott JD: Localization of the cAMP-dependent protein kinase to the postsynaptic densities by A-kinase anchoring proteins. Characterization of AKAP 79. J Biol Chem. 1992 Aug 25;267(24):16816-23. [PubMed:1512224 ]
  3. Hirsch AH, Glantz SB, Li Y, You Y, Rubin CS: Cloning and expression of an intron-less gene for AKAP 75, an anchor protein for the regulatory subunit of cAMP-dependent protein kinase II beta. J Biol Chem. 1992 Feb 5;267(4):2131-4. [PubMed:1733921 ]