You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08109
Secondary Accession Numbers
  • 13820
Name A-kinase anchor protein 8
Synonyms
  1. A-kinase anchor protein 95 kDa
  2. AKAP 95
  3. AKAP-8
Gene Name AKAP8
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
dna binding
Cellular Location
  1. Nucleus matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.1
SNPs AKAP8
Gene Sequence
>2079 bp
ATGGACCAGGGCTACGGAGGCTACGGGGCGTGGAGTGCTGGACCTGCCAACACCCAGGGT
GCATATGGAACTGGTGTGGCCAGCTGGCAAGGTTATGAAAACTACAATTACTATGGCGCC
CAGAACACCAGTGTCACCACAGGCGCAACCTACAGCTACGGCCCAGCCTCGTGGGAGGCC
GCCAAGGCCAATGATGGCGGCCTGGCGGCCGGGGCCCCTGCCATGCACATGGCCTCTTAC
GGCCCAGAGCCATGCACCGACAATTCCGACTCCCTCATTGCCAAGATCAACCAGCGTTTG
GACATGATGTCCAAGGAAGGAGGCAGGGGCGGGAGCGGCGGCGGTGGGGAGGGCATACAG
GACCGGGAGAGCTCCTTCCGCTTCCAGCCGTTCGAGTCCTATGACTCCAGGCCCTGCCTG
CCGGAGCACAACCCCTACCGCCCCAGCTACAGCTACGACTATGAGTTCGACCTGGGGTCC
GACCGCAATGGCAGCTTTGGGGGGCAGTACAGTGAATGCCGAGACCCAGCCCGGGAGCGG
GGCTCCCTTGATGGCTTCATGCGGGGCCGGGGCCAGGGCCGCTTCCAGGACCGGAGCAAC
CCTGGCACCTTCATGCGCAGCGACCCCTTCGTGCCCCCCGCTGCGTCCTCTGAGCCCCTG
TCCACGCCCTGGAACGAGCTGAACTACGTGGGTGGACGGGGCCTGGGAGGGCCCTCCCCC
AGCCGGCCACCTCCGTCCCTCTTCTCCCAGTCCATGGCTCCCGACTACGGCGTGATGGGC
ATGCAGGGGGCGGGCGGCTATGACAGCACCATGCCCTACGGATGTGGCCGCTCGCAGCCT
CGGATGCGGGATCGGGATCGGCCCAAGAGGAGAGGGTTTGACCGCTTCGGACCAGATGGC
ACGGGCAGGAAACGGAAGCAGTTCCAACTTTACGAGGAGCCAGACACCAAACTGGCCCGG
GTTGACAGTGAAGGAGATTTCTCCGAAAATGATGACGCAGCTGGTGACTTCCGCTCAGGA
GATGAAGAATTCAAGGGTGAGGATGAACTCTGCGACTCTGGGAGGCAAAGAGGAGAGAAG
GAGGACGAGGACGAGGATGTGAAGAAGAGAAGGGAAAAGCAAAGGAGAAGAGACAGGACG
CGGGACCGTGCAGCCGACAGAATTCAGTTTGCCTGTTCTGTATGCAAGTTCCGTAGCTTT
GATGACGAAGAGATCCAGAAGCATCTGCAAAGCAAATTTCACAAAGAGACCCTGCGGTTC
ATAAGCACCAAGCTGCCCGACAAGACCGTGGAGTTCCTCCAGGAATACATTGTAAACAGA
AATAAGAAAATTGAGAAGCGGCGTCAGGAATTGATGGAGAAAGAAACCGCAAAACCAAAA
CCAGATCCTTTCAAAGGGATTGGCCAGGAGCACTTCTTCAAGAAGATCGAGGCTGCTCAC
TGCCTGGCCTGCGACATGCTAATTCCTGCACAGCCGCAGCTCCTCCAGCGGCACCTGCAC
TCCGTGGACCACAATCACAACCGCAGGTTGGCTGCTGAACAGTTCAAGAAAACCAGTCTC
CATGTGGCTAAGAGTGTTTTGAACAACAGACATATAGTGAAGATGCTGGAAAAATACCTC
AAGGGTGAGGACCCTTTCACCAGTGAAACTGTTGATCCAGAAATGGAAGGAGATGACAAT
TTAGGAGGTGAGGATAAGAAAGAGACACCTGAGGAGGTGGCCGCGGACGTCTTAGCAGAG
GTGATTACAGCAGCAGTGAGGGCCGTAGATGGGGAAGGAGCGCCCGCTCCAGAGAGCAGC
GGGGAGCCGGCTGAGGACGAAGGCCCCACGGACACAGCGGAGGCCGGTAGTGATCCTCAA
GCCGAACAGCTGCTGGAAGAGCAGGTGCCCTGTGGAACGGCACATGAGAAGGGCGTCCCC
AAGGCCAGAAGTGAGGCTGCAGAGGCTGGAAATGGCGCCGAGACAATGGCAGCAGAGGCA
GAAAGTGCCCAAACCAGAGTTGCTCCTGCCCCAGCTGCCGCGGATGCTGAAGTGGAACAA
ACTGATGCAGAGTCTAAAGACGCTGTTCCCACAGAATGA
Protein Properties
Number of Residues 692
Molecular Weight 76107.7
Theoretical pI 4.77
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>A-kinase anchor protein 8
MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEA
AKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQ
DRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARER
GSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSP
SRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDG
TGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEK
EDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAH
CLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYL
KGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESS
GEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEA
ESAQTRVAPAPAAADAEVEQTDAESKDAVPTE
GenBank ID Protein 3702291
UniProtKB/Swiss-Prot ID O43823
UniProtKB/Swiss-Prot Entry Name AKAP8_HUMAN
PDB IDs Not Available
GenBank Gene ID AC005785
GeneCard ID AKAP8
GenAtlas ID AKAP8
HGNC ID HGNC:378
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  10. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  11. Eide T, Coghlan V, Orstavik S, Holsve C, Solberg R, Skalhegg BS, Lamb NJ, Langeberg L, Fernandez A, Scott JD, Jahnsen T, Tasken K: Molecular cloning, chromosomal localization, and cell cycle-dependent subcellular distribution of the A-kinase anchoring protein, AKAP95. Exp Cell Res. 1998 Feb 1;238(2):305-16. [PubMed:9473338 ]