You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08119
Secondary Accession Numbers
  • 13830
Name Cyclic AMP-responsive element-binding protein 3-like protein 1
Synonyms
  1. OASIS
  2. Old astrocyte specifically-induced substance
  3. Processed cyclic AMP-responsive element-binding protein 3-like protein 1
  4. cAMP-responsive element-binding protein 3-like protein 1
Gene Name CREB3L1
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Specifically involved in ER-stress response in astrocytes in the central nervous system (By similartity). May play a role in gliosis. In vitro, binds to box-B element, cAMP response element (CRE) and CRE-like sequences, and activates transcription through box-B element but not through CRE
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
protein binding
nucleic acid binding
dna binding
protein dimerization activity
sequence-specific dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Processed cyclic AMP-responsive element- binding protein 3-like protein 1:Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 11p11.2
SNPs CREB3L1
Gene Sequence
>1560 bp
ATGGACGCCGTCTTGGAACCCTTCCCGGCCGACAGGCTGTTCCCCGGATCCAGCTTCCTG
GACTTGGGGGATCTGAACGAGTCGGACTTCCTCAACAATGCGCACTTTCCTGAGCACCTG
GACCACTTTACGGAGAACATGGAGGACTTCTCCAATGACCTGTTCAGCAGCTTCTTTGAT
GACCCTGTGCTGGATGAGAAGAGCCCTCTATTGGACATGGAACTGGACTCCCCTACGCCA
GGCATCCAGGCGGAGCACAGCTACTCCCTGAGCGGCGACTCAGCGCCCCAGAGCCCCCTT
GTGCCCATCAAGATGGAGGACACCACCCAAGATGCAGAGCATGGAGCATGGGCGCTGGGA
CACAAACTGTGCTCCATCATGGTGAAGCAGGAGCAGAGCCCGGAGCTGCCCGTGGACCCT
CTGGCTGCCCCCTCGGCCATGGCTGCCGCGGCCGCCATGGCCACCACCCCGCTGCTGGGC
CTCAGCCCCTTGTCCAGGCTGCCCATCCCCCACCAGGCCCCGGGAGAGATGACTCAGCTG
CCAGTGATCAAAGCAGAGCCTCTGGAGGTGAACCAGTTCCTCAAAGTGACACCGGAGGAC
CTGGTGCAGATGCCTCCGACGCCCCCCAGCAGCCATGGCAGTGACAGCGACGGCTCCCAG
AGTCCCCGCTCTCTGCCCCCCTCCAGCCCTGTCAGGCCCATGGCGCGCTCCTCCACGGCC
ATCTCCACCTCCCCACTCCTCACTGCCCCTCACAAATTACAGGGGACATCAGGGCCACTG
CTCCTGACAGAGGAGGAGAAGCGGACCCTGATTGCTGAGGGCTACCCCATCCCCACAAAA
CTCCCCCTCACCAAAGCCGAGGAGAAGGCCTTGAAGAGAGTCCGGAGGAAAATCAAGAAC
AAGATCTCAGCCCAGGAGAGCCGTCGTAAGAAGAAGGAGTATGTGGAGTGTCTAGAAAAG
AAGGTGGAGACATTTACATCTGAGAACAATGAACTGTGGAAGAAGGTGGAGACCCTGGAG
AATGCCAACAGGACCCTGCTCCAGCAGCTGCAGAAACTCCAGACTCTGGTCACCAACAAG
ATCTCCAGACCTTACAAGATGGCCGCCACCCAGACTGGGACCTGCCTCATGGTGGCAGCC
TTGTGCTTTGTTCTGGTGCTGGGCTCCCTCGTGCCCTGCCTTCCCGAGTTCTCCTCCGGC
TCCCAGACTGTGAAGGAAGACCCCCTGGCCGCAGACGGCGTCTACACGGCCAGCCAGATG
CCCTCCCGAAGCCTCCTATTCTACGATGACGGGGCAGGCTTATGGGAAGATGGCCGCAGC
ACCCTGCTGCCCATGGAGCCCCCAGATGGCTGGGAAATCAACCCCGGGGGGCCGGCAGAG
CAGCGGCCCCGGGACCACCTGCAGCATGATCACCTGGACAGCACCCACGAGACCACCAAG
TACCTGAGTGAGGCCTGGCCTAAAGACGGTGGAAACGGCACCAGCCCCGACTTCTCCCAC
TCCAAGGAGTGGTTCCACGACAGGGATCTGGGCCCCAACACCACCATCAAACTCTCCTAG
Protein Properties
Number of Residues 519
Molecular Weight 57004.8
Theoretical pI 4.81
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 375-395
Protein Sequence
>Cyclic AMP-responsive element-binding protein 3-like protein 1
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPLEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQM
PSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTK
YLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
GenBank ID Protein 21668502
UniProtKB/Swiss-Prot ID Q96BA8
UniProtKB/Swiss-Prot Entry Name CR3L1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB063321
GeneCard ID CREB3L1
GenAtlas ID CREB3L1
HGNC ID HGNC:18856
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Omori Y, Imai J, Suzuki Y, Watanabe S, Tanigami A, Sugano S: OASIS is a transcriptional activator of CREB/ATF family with a transmembrane domain. Biochem Biophys Res Commun. 2002 Apr 26;293(1):470-7. [PubMed:12054625 ]
  4. Murakami T, Kondo S, Ogata M, Kanemoto S, Saito A, Wanaka A, Imaizumi K: Cleavage of the membrane-bound transcription factor OASIS in response to endoplasmic reticulum stress. J Neurochem. 2006 Feb;96(4):1090-100. Epub 2006 Jan 17. [PubMed:16417584 ]