You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08149
Secondary Accession Numbers
  • 13860
Name Homeobox protein Meis1
Synonyms Not Available
Gene Name MEIS1
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleic acid binding
dna binding
sequence-specific dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:2
Locus 2p14
SNPs MEIS1
Gene Sequence
>1173 bp
ATGGCGCAAAGGTACGACGATCTACCCCATTACGGGGGCATGGATGGAGTAGGCATCCCC
TCCACGATGTATGGGGACCCGCATGCAGCCAGGTCCATGCAGCCGGTCCACCACCTGAAC
CACGGGCCTCCTCTGCACTCGCATCAGTACCCGCACACAGCTCATACCAACGCCATGGCC
CCCAGCATGGGCTCCTCTGTCAATGACGCTTTAAAGAGAGATAAAGATGCCATTTATGGA
CACCCCCTCTTCCCTCTCTTAGCACTGATTTTTGAGAAATGTGAATTAGCTACTTGTACC
CCCCGCGAGCCGGGGGTGGCGGGCGGGGACGTCTGCTCGTCAGAGTCATTCAATGAAGAT
ATAGCCGTGTTCGCCAAACAGATTCGCGCAGAAAAACCTCTATTTTCTTCTAATCCAGAA
CTGGATAACTTGATGATTCAAGCCATACAAGTATTAAGGTTTCATCTATTGGAATTAGAG
AAGGTACACGAATTATGTGACAATTTCTGCCACCGGTATATTAGCTGTTTGAAAGGGAAA
ATGCCTATCGATTTGGTGATAGACGATAGAGAAGGAGGATCAAAATCAGACAGTGAAGAT
ATAACAAGATCAGCAAATCTAACTGACCAGCCCTCTTGGAACAGAGATCATGATGACACG
GCATCTACTCGTTCAGGAGGAACCCCAGGCCCTTCCAGCGGTGGCCACACGTCACACAGT
GGGGACAACAGCAGTGAGCAAGGTGATGGCTTGGACAACAGTGTAGCTTCCCCCAGCACA
GGTGACGATGATGACCCTGATAAGGACAAAAAGCGTCACAAAAAGCGTGGCATCTTTCCC
AAAGTAGCCACAAATATCATGAGGGCGTGGCTGTTCCAGCATCTAACACACCCTTACCCT
TCTGAAGAACAGAAAAAGCAGTTGGCACAAGACACGGGACTCACCATCCTTCAAGTGAAC
AATTGGTTTATTAATGCCCGGAGAAGAATAGTGCAGCCCATGATAGACCAGTCCAACCGA
GCAGTAAGTCAAGGAACACCTTATAATCCTGATGGACAGCCCATGGGAGGTTTCGTAATG
GACGGTCAGCAACATATGGGAATTAGAGCACCAGGACCTATGAGTGGAATGGGCATGAAT
ATGGGCATGGAGGGGCAGTGGCACTACATGTAA
Protein Properties
Number of Residues 390
Molecular Weight 43015.8
Theoretical pI 6.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Homeobox protein Meis1
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA
PSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNED
IAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGK
MPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHS
GDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVM
DGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
GenBank ID Protein 4505151
UniProtKB/Swiss-Prot ID O00470
UniProtKB/Swiss-Prot Entry Name MEIS1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002398.2
GeneCard ID MEIS1
GenAtlas ID MEIS1
HGNC ID HGNC:7000
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Smith JE Jr, Bollekens JA, Inghirami G, Takeshita K: Cloning and mapping of the MEIS1 gene, the human homolog of a murine leukemogenic gene. Genomics. 1997 Jul 1;43(1):99-103. [PubMed:9226379 ]
  4. Okada Y, Nagai R, Sato T, Matsuura E, Minami T, Morita I, Doi T: Homeodomain proteins MEIS1 and PBXs regulate the lineage-specific transcription of the platelet factor 4 gene. Blood. 2003 Jun 15;101(12):4748-56. Epub 2003 Feb 27. [PubMed:12609849 ]
  5. Vilarino-Guell C, Chai H, Keeling BH, Young JE, Rajput A, Lynch T, Aasly JO, Uitti RJ, Wszolek ZK, Farrer MJ, Lin SC: MEIS1 p.R272H in familial restless legs syndrome. Neurology. 2009 Jul 21;73(3):243-5. doi: 10.1212/WNL.0b013e3181ae7c79. [PubMed:19620614 ]