You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08167
Secondary Accession Numbers
  • 13878
Name Relaxin-3 receptor 1
Synonyms
  1. G protein-coupled receptor SALPR
  2. G-protein coupled receptor GPCR135
  3. RLN3 receptor 1
  4. Relaxin family peptide receptor 3
  5. Somatostatin- and angiotensin-like peptide receptor
Gene Name RXFP3
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for RNL3/relaxin-3. Binding of the ligand inhibit cAMP accumulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
n-formyl peptide receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5p15.1-p14
SNPs RXFP3
Gene Sequence
>1410 bp
ATGCAGATGGCCGATGCAGCCACGATAGCCACCATGAATAAGGCAGCAGGCGGGGACAAG
CTAGCAGAACTCTTCAGTCTGGTCCCGGACCTTCTGGAGGCGGCCAACACGAGTGGTAAC
GCGTCGCTGCAGCTTCCGGACTTGTGGTGGGAGCTGGGGCTGGAGTTGCCGGACGGCGCG
CCGCCAGGACATCCCCCGGGCAGCGGCGGGGCAGAGAGCGCGGACACAGAGGCCCGGGTG
CGGATTCTCATCAGCGTGGTGTACTGGGTGGTGTGCGCCCTGGGGTTGGCGGGCAACCTG
CTGGTTCTCTACCTGATGAAGAGCATGCAGGGCTGGCGCAAGTCCTCTATCAACCTCTTC
GTCACCAACCTGGCGCTGACGGACTTTCAGTTTGTGCTCACCCTGCCCTTCTGGGCGGTG
GAGAACGCTCTTGACTTCAAATGGCCCTTCGGCAAGGCCATGTGTAAGATCGTGTCCATG
GTGACGTCCATGAACATGTACGCCAGCGTGTTCTTCCTCACTGCCATGAGTGTGACGCGC
TACCATTCGGTGGCCTCGGCTCTGAAGAGCCACCGGACCCGAGGACACGGCCGGGGCGAC
TGCTGCGGCCGGAGCCTGGGGGACAGCTGCTGCTTCTCGGCCAAGGCGCTGTGTGTGTGG
ATCTGGGCTTTGGCCGCGCTGGCCTCGCTGCCCAGTGCCATTTTCTCCACCACGGTCAAG
GTGATGGGCGAGGAGCTGTGCCTGGTGCGTTTCCCGGACAAGTTGCTGGGCCGCGACAGG
CAGTTCTGGCTGGGCCTCTACCACTCGCAGAAGGTGCTGCTGGGCTTCGTGCTGCCGCTG
GGCATCATTATCTTGTGCTACCTGCTGCTGGTGCGCTTCATCGCCGACCGCCGCGCGGCG
GGGACCAAAGGAGGGGCCGCGGTAGCCGGAGGACGCCCGACCGGAGCCAGCGCCCGGAGA
CTGTCGAAGGTCACCAAATCAGTGACCATCGTTGTCCTGTCCTTCTTCCTGTGTTGGCTG
CCCAACCAGGCGCTCACCACCTGGAGCATCCTCATCAAGTTCAACGCGGTGCCCTTCAGC
CAGGAGTATTTCCTGTGCCAGGTATACGCGTTCCCTGTGAGCGTGTGCCTAGCGCACTCC
AACAGCTGCCTCAACCCCGTCCTCTACTGCCTCGTGCGCCGCGAGTTCCGCAAGGCGCTC
AAGAGCCTGCTGTGGCGCATCGCGTCTCCTTCGATCACCAGCATGCGCCCCTTCACCGCC
ACTACCAAGCCGGAGCACGAGGATCAGGGGCTGCAGGCCCCGGCGCCGCCCCACGCGGCC
GCGGAGCCGGACCTGCTCTACTACCCACCTGGCGTCGTGGTCTACAGCGGGGGGCGCTAC
GACCTGCTGCCCAGCAGCTCTGCCTACTGA
Protein Properties
Number of Residues 469
Molecular Weight 51123.2
Theoretical pI 8.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 82-102
  • 120-140
  • 157-177
  • 216-236
  • 271-291
  • 330-350
  • 357-377
Protein Sequence
>Relaxin-3 receptor 1
MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA
PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF
VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR
YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK
VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA
GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS
QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA
TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY
GenBank ID Protein 29824922
UniProtKB/Swiss-Prot ID Q9NSD7
UniProtKB/Swiss-Prot Entry Name RL3R1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY236541
GeneCard ID RXFP3
GenAtlas ID RXFP3
HGNC ID HGNC:24883
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Matsumoto M, Kamohara M, Sugimoto T, Hidaka K, Takasaki J, Saito T, Okada M, Yamaguchi T, Furuichi K: The novel G-protein coupled receptor SALPR shares sequence similarity with somatostatin and angiotensin receptors. Gene. 2000 May 2;248(1-2):183-9. [PubMed:10806363 ]
  3. Liu C, Eriste E, Sutton S, Chen J, Roland B, Kuei C, Farmer N, Jornvall H, Sillard R, Lovenberg TW: Identification of relaxin-3/INSL7 as an endogenous ligand for the orphan G-protein-coupled receptor GPCR135. J Biol Chem. 2003 Dec 12;278(50):50754-64. Epub 2003 Sep 30. [PubMed:14522968 ]