You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08174
Secondary Accession Numbers
  • 13885
Name A-kinase anchor protein SPHKAP
Synonyms
  1. SPHK1-interactor and AKAP domain-containing protein
  2. Sphingosine kinase type 1-interacting protein
Gene Name SPHKAP
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II). May act as a converging factor linking cAMP and sphingosine signaling pathways. Plays a regulatory role in the modulation of SPHK1
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 2q36
SNPs SPHKAP
Gene Sequence
>5103 bp
ATGGATGGCAACTCCCTGCTCTCGGTACCAAGCAACTTGGAGTCATCACGGATGTATGAC
GTTTTGGAACCGCAGCAGGGCAGAGGCTGTGGCAGCTCAGGAAGCGGCCCGGGGAACTCC
ATCACAGCCTGTAAGAAGGTTCTTCGCAGCAATAGCCTGCTGGAGTCAACAGACTACTGG
TTGCAGAATCAGAGGATGCCCTGCCAAATTGGTTTTGTAGAAGACAAGTCTGAAAACTGT
GCTTCTGTCTGCTTTGTGAATCTTGATGTGAACAAGGATGAATGCAGCACAGAGCACCTG
CAACAGAAACTGGTCAACGTTTCACCAGATCTTCCAAAACTTATCAGTTCCATGAATGTC
CAACAACCAAAAGAAAATGAAATTGTTGTCCTAAGTGGGTTAGCCTCTGGAAATCTCCAG
GCAGATTTTGAAGTTTCACAGTGCCCTTGGCTGCCAGATATCTGCTTGGTCCAATGTGCA
AGAGGGAACAGACCAAACAGTACCAACTGCATCATCTTTGAAATCAACAAATTTCTGATT
GGTCTGGAACTGGTGCAGGAGCGACAGCTCCACCTGGAAACAAACATCTTGAAACTGGAG
GATGACACGAACTGTTCCTTATCTTCAATCGAGGAAGACTTTCTCACCGCTTCTGAGCAC
TTGGAGGAGGAAAGCGAGGTGGATGAATCTAGGAACGATTATGAAAATATAAATGTCTCA
GCCAATGTTTTGGAAAGTAAACAGCTAAAGGGAGCCACCCAGGTGGAATGGAATTGCAAC
AAGGAAAAGTGGCTTTATGCTTTGGAAGACAAATACATCAACAAATATCCCACACCATTG
ATTAAAACAGAACGATCTCCAGAAAACCTAACAAAGAACACAGCCTTGCAGAGTCTAGAT
CCCTCAGCCAAGCCATCACAGTGGAAAAGAGAAGCTGTGGGGAATGGGAGACAAGCCACA
CATTATTATCATTCAGAAGCTTTTAAAGGTCAAATGGAAAAATCACAGGCACTGTATATT
CCAAAAGATGCTTATTTCTCCATGATGGATAAAGATGTACCTTCTGCATGTGCTGTGGCA
GAGCAGAGAAGCAACCTAAACCCAGGAGACCATGAAGACACAAGAAACGCTCTCCCTCCT
AGACAAGATGGAGAAGTCACCACTGGCAAGTATGCTACAAATTTAGCAGAATCCGTGCTG
CAGGATGCATTTATTAGATTATCTCAATCTCAGTCCACATTACCCCAGGAATCTGCAGTC
AGTGTTTCTGTAGGAAGTTCTCTGCTTCCCAGTTGCTATTCCACAAAAGATACAGTGGTT
TCTCGGTCATGGAATGAGCTCCCCAAAATCGTCGTTGTTCAGAGTCCAGATGGCAGTGAT
GCTGCCCCACAGCCAGGCATCTCCTCCTGGCCTGAGATGGAAGTCTCTGTTGAAACCTCA
AGCATCCTCTCTGGAGAGAACTCCAGCAGACAACCCCAGAGTGCTCTAGAAGTGGCGTTA
GCTTGTGCAGCCACTGTGATTGGAACTATTTCCAGTCCACAGGCCACAGAAAGACTCAAA
ATGGAGCAAGTGGTCTCGAACTTTCCCCCAGGGAGCAGTGGTGCACTGCAAACTCAAGCA
CCCCAAGGACTCAAGGAACCTTCCATCAATGAGTACTCCTTTCCATCTGCTTTGTGTGGC
ATGACTCAGGTGGCCAGTGCCGTGGCTGTCTGTGGTCTGGGTGAAAGAGAAGAGGTGACA
TGCTCAGTGGCTCCAAGTGGTAGCCTCCCGCCTGCAGCTGAGGCTTCTGAAGCCATGCCC
CCACTTTGTGGTTTAGCAAGCATGGAGCTTGGCAAGGAAGCCATTGCCAAGGGATTGCTC
AAGGAGGCTGCTCTGGTTTTAACAAGGCCTAATACCTACAGCAGCATTGGAGACTTTCTG
GACTCCATGAACAGGAGAATCATGGAAACTGCTTCAAAGTCTCAGACCCTGTGCTCAGAA
AATGTCGTCAGGAATGAACTGGCACATACCCTGTCCAATGTTATCCTGAGGCATTCCATT
GATGAAGTTCACCACAAAAATATGATAATCGACCCCAATGACAACAGGCATTCATCTGAA
ATTCTGGACACCTTAATGGAAAGTACAAATCAACTGCTTTTAGATGTGATATGCTTCACG
TTCAAGAAGATGAGTCATATTGTACGGCTTGGTGAATGTCCTGCTGTCCTTTCTAAGGAG
ACCATCAGAAGGAGGGAGACAGAACCAAGCTGCCAGCCATCTGATCCGGGTGCTAGTCAA
GCTTGGACAAAAGCCACTGAATCCTCCAGCAGCTCTCCACTTAGCAATTCACACAACACG
AGTCTTGTCATCAACAATCTTGTGGATGGCATGTATTCAAAACAAGACAAGGGTGGAGTG
AGGCCAGGCCTCTTCAAGAACCCCACGCTGCAGTCACAATTATCACGTAGTCACAGAGTG
CCCGATTCTTCAACTGCTACAACATCCTCCAAGGAAATATATCTGAAAGGAATAGCAGGA
GAGGATACAAAAAGCCCTCATCACAGTGAGAATGAATGCAGAGCCTCTTCCGAAGGACAA
AGGTCCCCAACGGTCAGCCAGTCCAGAAGTGGTTCCCAGGAGGCTGAGGAGAGTATCCAC
CCAAACACCCAAGAAAAGTACAACTGTGCCACATCTCGCATCAACGAAGTTCAAGTCAAC
CTGTCCTTGTTAGGGGATGACCTGCTGCTTCCTGCTCAATCCACGCTTCAAACAAAGCAT
CCAGACATCTACTGCATTACAGACTTTGCGGAAGAATTAGCAGACACGGTCGTCTCCATG
GCAACTGAAATTGCAGCGATTTGCCTTGACAACTCCAGTGGAAAACAACCCTGGTTTTGT
GCATGGAAAAGAGGGAGTGAGTTTCTGATGACACCCAACGTACCCTGCCGATCCTTGAAG
AGGAAGAAAGAGAGCCAGGGGAGCGGGACCGCTGTGAGGAAACACAAGCCTCCCCGGCTC
AGTGAGATCAAGAGGAAGACGGACGAGCACCCTGAGCTTAAAGAAAAGCTGATGAACAGG
GTTGTGGATGAGTCCATGAACCTTGAAGATGTCCCAGATTCTGTCAATCTTTTTGCCAAT
GAAGTGGCAGCCAAGATCATGAACCTAACGGAGTTCTCTATGGTGGACGGCATGTGGCAG
GCGCAGGGCTATCCCCGGAATCGGTTACTGAGTGGCGACAGGTGGAGCCGGCTGAAGGCC
TCCAGCTGCGAAAGCATTCCTGAGGAAGACTCCGAGGCCAGGGCCTATGTCAACAGCCTG
GGCTTAATGAGCACGCTGAGCCAGCCGGTCAGCAGGGCCAGCTCTGTCTCCAAGCAGTCG
AGCTGTGAGAGCATCACCGATGAGTTTTCCAGGTTCATGGTGAACCAGATGGAAAATGAA
GGGAGAGGATTTGAGTTACTGCTGGATTACTATGCTGGCAAGAACGCCAGCAGCATTCTG
AACTCAGCCATGCAACAGGCGTGCCGGAAAAGTGACCACCTCAGTGTGAGGCCTAGCTGT
CCCTCTAAGCAGTCCAGCACAGAGAGCATCACTGAGGAGTTCTACAGGTACATGCTGAGG
GACATCGAAAGAGACAGCAGAGAAAGTGCCTCCTCCAGACGGAGCAGCCAGGATTGGACA
GCCGGCCTGCTGTCTCCTTCTCTGCGATCCCCAGTGTGCCACAGACAGTCGTCCATGCCA
GACAGCAGATCCCCATGCTCCAGGCTGACAGTGAATGTGCCCATCAAAGCCAACTCTTTA
GATGGCTTTGCTCAGAACTGCCCACAAGATTTCCTAAGCGTGCAGCCGGTCAGTAGCGCG
TCCTCATCCGGTCTCTGCAAATCTGACTCTTGCTTGTATCGGAGAGGTGGGACTGACCAC
ATCACCAACATGTTAATTCATGAAACGTGGGCTAGCTCCATTGAGGCTCTCATGCGCAAG
AACAAAATCATTGTGGATGATGCAGAGGAAGCTGACACTGAGCCTGTTTCTGGTGGCTCT
CCCTCGCAAGCAGAGAAGTGTGCAAATAGATTAGCTGCGAGCAGGATGTGCAGTGGGCCA
ACTCTGCTTGTTCAGGAGTCTCTCGATTGCCCGAGGAAAGACTCTGTTACCGAATGTAAA
CAGCCCCCAGTGTCATCTTTGAGCAAAACTGCTTCTCTTACAAACCACAGCCCTTTAGAT
TCTAAAAAAGAAACTTCCTCGTGCCAGGACCCTGTACCAATAAACCACAAAAGGCGATCA
CTTTGCTCGAGGGAAGTGCCTTTGATTCAGATTGAAACAGATCAGAGAGAAGCCTGTGCT
GGGGAACCTGAACCCTTCCTTTCCAAAAGCAGCCTCCTAGAGGAAGCAGAAGGGCATTCG
AATGACAAAAACATCCCAGATGTGGTGAGAGGTGGAGACACAGCCGTGAGCGCTTGTCAA
ATCCATAGTGACAGCCTTGATACCAGAGATGTACCAGAGGCTGAAGCCTCCACAGAAGCC
AGAGCCCCCGATGAGGCCCCCAACCCTCCAAGCAGCAGCGAGGAGAGCACAGGCAGCTGG
ACCCAGCTTGCCAATGAGGAAGACAACCCAGATGACACAAGTAGCTTTCTCCAGCTCAGT
GAGCGATCCATGAGCAATGGCAACAGTAGTGCCACTAGCAGTCTTGGCATTATGGATCTG
GACATTTATCAGGAAAGCATGCCATCTTCTCCCATGATTAATGAATTAGTAGAAGAAAAG
AAGATTCTTAAAGGACAGTCAGAAAGCACAGAGGCACCTGCATCTGGACCGCCTACGGGA
ACAGCCAGCCCCCAGAGGAGCCTGCTGGTGATCAACTTTGACCTGGAGCCAGAGTGTCCA
GATGCCGAGCTCCGAGCCACTCTGCAGTGGATAGCTGCCTCTGAACTGGGGATTCCCACC
ATCTACTTTAAGAAATCTCAGGAAAACAGAATTGAAAAGTTTCTAGATGTCGTGCAGCTG
GTTCATCGGAAGTCCTGGAAAGTGGGTGATATCTTCCATGCAGTTGTCCAGTACTGCAAA
ATGCATGAGGAGCAGAAGGATGGGAGACTGAGTCTCTTTGACTGGCTCTTGGAACTGGGA
TAA
Protein Properties
Number of Residues 1700
Molecular Weight 186454.3
Theoretical pI 4.78
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>A-kinase anchor protein SPHKAP
MDGNSLLSVPSNLESSRMYDVLEPQQGRGCGSSGSGPGNSITACKKVLRSNSLLESTDYW
LQNQRMPCQIGFVEDKSENCASVCFVNLDVNKDECSTEHLQQKLVNVSPDLPKLISSMNV
QQPKENEIVVLSGLASGNLQADFEVSQCPWLPDICLVQCARGNRPNSTNCIIFEINKFLI
GLELVQERQLHLETNILKLEDDTNCSLSSIEEDFLTASEHLEEESEVDESRNDYENINVS
ANVLESKQLKGATQVEWNCNKEKWLYALEDKYINKYPTPLIKTERSPENLTKNTALQSLD
PSAKPSQWKREAVGNGRQATHYYHSEAFKGQMEKSQALYIPKDAYFSMMDKDVPSACAVA
EQRSNLNPGDHEDTRNALPPRQDGEVTTGKYATNLAESVLQDAFIRLSQSQSTLPQESAV
SVSVGSSLLPSCYSTKDTVVSRSWNELPKIVVVQSPDGSDAAPQPGISSWPEMEVSVETS
SILSGENSSRQPQSALEVALACAATVIGTISSPQATERLKMEQVVSNFPPGSSGALQTQA
PQGLKEPSINEYSFPSALCGMTQVASAVAVCGLGEREEVTCSVAPSGSLPPAAEASEAMP
PLCGLASMELGKEAIAKGLLKEAALVLTRPNTYSSIGDFLDSMNRRIMETASKSQTLCSE
NVVRNELAHTLSNVILRHSIDEVHHKNMIIDPNDNRHSSEILDTLMESTNQLLLDVICFT
FKKMSHIVRLGECPAVLSKETIRRRETEPSCQPSDPGASQAWTKATESSSSSPLSNSHNT
SLVINNLVDGMYSKQDKGGVRPGLFKNPTLQSQLSRSHRVPDSSTATTSSKEIYLKGIAG
EDTKSPHHSENECRASSEGQRSPTVSQSRSGSQEAEESIHPNTQEKYNCATSRINEVQVN
LSLLGDDLLLPAQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFC
AWKRGSEFLMTPNVPCRSLKRKKESQGSGTAVRKHKPPRLSEIKRKTDEHPELKEKLMNR
VVDESMNLEDVPDSVNLFANEVAAKIMNLTEFSMVDGMWQAQGYPRNRLLSGDRWSRLKA
SSCESIPEEDSEARAYVNSLGLMSTLSQPVSRASSVSKQSSCESITDEFSRFMVNQMENE
GRGFELLLDYYAGKNASSILNSAMQQACRKSDHLSVRPSCPSKQSSTESITEEFYRYMLR
DIERDSRESASSRRSSQDWTAGLLSPSLRSPVCHRQSSMPDSRSPCSRLTVNVPIKANSL
DGFAQNCPQDFLSVQPVSSASSSGLCKSDSCLYRRGGTDHITNMLIHETWASSIEALMRK
NKIIVDDAEEADTEPVSGGSPSQAEKCANRLAASRMCSGPTLLVQESLDCPRKDSVTECK
QPPVSSLSKTASLTNHSPLDSKKETSSCQDPVPINHKRRSLCSREVPLIQIETDQREACA
GEPEPFLSKSSLLEEAEGHSNDKNIPDVVRGGDTAVSACQIHSDSLDTRDVPEAEASTEA
RAPDEAPNPPSSSEESTGSWTQLANEEDNPDDTSSFLQLSERSMSNGNSSATSSLGIMDL
DIYQESMPSSPMINELVEEKKILKGQSESTEAPASGPPTGTASPQRSLLVINFDLEPECP
DAELRATLQWIAASELGIPTIYFKKSQENRIEKFLDVVQLVHRKSWKVGDIFHAVVQYCK
MHEEQKDGRLSLFDWLLELG
GenBank ID Protein 85397610
UniProtKB/Swiss-Prot ID Q2M3C7
UniProtKB/Swiss-Prot Entry Name SPKAP_HUMAN
PDB IDs Not Available
GenBank Gene ID BC104954
GeneCard ID SPHKAP
GenAtlas ID SPHKAP
HGNC ID HGNC:30619
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. [PubMed:11214970 ]
  4. Lacana E, Maceyka M, Milstien S, Spiegel S: Cloning and characterization of a protein kinase A anchoring protein (AKAP)-related protein that interacts with and regulates sphingosine kinase 1 activity. J Biol Chem. 2002 Sep 6;277(36):32947-53. Epub 2002 Jun 21. [PubMed:12080051 ]