You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08188
Secondary Accession Numbers
  • 13899
Name Chloride transport protein 6
Synonyms
  1. Chloride channel protein 6
  2. ClC-6
Gene Name CLCN6
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
signal transduction
cell volume homeostasis
Cellular Component
endosome membrane
integral to membrane
Component
membrane
cell part
Function
voltage-gated chloride channel activity
anion channel activity
chloride channel activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Molecular Function
ATP binding
antiporter activity
voltage-gated chloride channel activity
Process
establishment of localization
transport
chloride transport
transmembrane transport
anion transport
inorganic anion transport
ion transport
Cellular Location
  1. Endosome membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 1
Locus 1p36
SNPs CLCN6
Gene Sequence
>2610 bp
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAG
CGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGAT
GAGATTCTTCCAAGGAAAGACTATGAGAGTTTGGATTATGATCGCTGTATCAATGACCCT
TACCTGGAAGTTTTGGAGACCATGGATAATAAGAAAGGTCGAAGATATGAGGCGGTGAAG
TGGATGGTGGTGTTTGCCATTGGAGTCTGCACTGGCCTGGTGGGTCTCTTTGTGGACTTT
TTTGTGCGACTCTTCACCCAACTCAAGTTCGGAGTGGTACAGACATCGGTGGAGGAGTGC
AGCCAGAAAGGCTGCCTCGCTCTGTCTCTCCTTGAACTCCTGGGTTTTAACCTCACCTTT
GTCTTCCTGGCAAGCCTCCTTGTTCTCATTGAGCCGGTGGCAGCAGGTTCCGGGATACCC
GAGGTCAAATGCTATCTGAATGGCGTAAAGGTGCCAGGAATCGTCCGTCTCCGGACCCTG
CTCTGCAAGGTCCTTGGAGTGCTGTTCAGTGTGGCTGGAGGGCTCTTCGTGGGGAAGGAA
GGCCCCATGATCCACAGTGGTTCGGTGGTGGGAGCTGGCCTCCCTCAGTTTCAGAGCATC
TCCTTACGGAAGATCCAGTTTAACTTCCCCTATTTCCGAAGCGACAGAGACAAGAGAGAC
TTTGTATCAGCAGGAGCGGCTGCTGGAGTTGCTGCAGCTTTCGGGGCGCCAATCGGGGGT
ACCTTGTTCAGTCTAGAGGAGGGTTCGTCCTTCTGGAACCAAGGGCTCACGTGGAAAGTG
CTCTTTTGTTCCATGTCTGCCACCTTCACCCTCAACTTCTTCCGTTCTGGGATTCAGTTT
GGAAGCTGGGGTTCCTTCCAGCTCCCTGGATTGCTGAACTTTGGCGAGTTTAAGTGCTCT
GACTCTGATAAAAAATGTCATCTCTGGACAGCTATGGATTTGGGTTTCTTCGTCGTGATG
GGGGTCATTGGGGGCCTCCTGGGAGCCACATTCAACTGTCTGAACAAGAGGCTTGCAAAG
TACCGTATGCGAAACGTGCACCCGAAACCTAAGCTCGTCAGAGTCTTAGAGAGCCTCCTT
GTGTCTCTGGTAACCACCGTGGTGGTGTTTGTGGCCTCGATGGTGTTAGGAGAATGCCGA
CAGATGTCCTCTTCGAGTCAAATCGGTAATGACTCATTCCAGCTCCAGGTCACAGAAGAT
GTGAATTCAAGTATCAAGACATTTTTTTGTCCCAATGATACCTACAATGACATGGCCACA
CTCTTCTTCAACCCGCAGGAGTCTGCCATCCTCCAGCTCTTCCACCAGGATGGTACTTTC
AGCCCCGTCACTCTGGCCTTGTTCTTCGTTCTCTATTTCTTGCTTGCATGTTGGACTTAC
GGCATTTCTGTTCCAAGTGGCCTTTTTGTGCCTTCTCTGCTGTGTGGAGCTGCTTTTGGA
CGTTTAGTTGCCAATGTCCTAAAAAGCTACATTGGATTGGGCCACATCTATTCGGGGACC
TTTGCCCTGATTGGTGCAGCGGCTTTCTTGGGCGGGGTGGTCCGCATGACCATCAGCCTC
ACGGTCATCCTGATCGAGTCCACCAATGAGATCACCTACGGGCTCCCCATCATGGTCACA
CTGATGGTGGCCAAATGGACAGGGGACTTTTTCAATAAGGGCATTTATGATATCCACGTG
GGCCTGCGAGGCGTGCCGCTTCTGGAATGGGAGACAGAGGTGGAAATGGACAAGCTGAGA
GCCAGCGACATCATGGAGCCCAACCTGACCTACGTCTACCCGCACACCCGCATCCAGTCT
CTGGTGAGCATCCTGCGCACCACGGTCCACCATGCCTTCCCGGTGGTCACAGAGAACCGC
GGTAACGAGAAGGAGTTCATGAAGGGCAACCAGCTCATCAGCAACAACATCAAGTTCAAG
AAATCCAGCATCCTCACCCGGGCTGGCGAGCAGCGCAAACGGAGCCAGTCCATGAAGTCC
TACCCATCCAGCGAGCTACGGAACATGTGTGATGAGCACATCGCCTCTGAGGAGCCAGCC
GAGAAGGAGGACCTCCTGCAGCAGATGCTGGAAAGGAGATACACTCCCTACCCCAACCTA
TACCCTGACCAGTCCCCAAGTGAAGACTGGACCATGGAGGAGCGGTTCCGCCCTCTGACC
TTCCACGGCCTGATCCTTCGGTCGCAGCTTGTCACCCTGCTTGTCCGAGGAGTTTGTTAC
TCTGAAAGCCAGTCGAGCGCCAGCCAGCCGCGCCTCTCCTATGCCGAGATGGCCGAGGAC
TACCCGCGGTACCCCGACATCCACGACCTGGACCTGACGCTGCTCAACCCGCGCATGATC
GTGGATGTCACCCCATACATGAACCCTTCGCCTTTCACCGTCTCGCCCAACACCCACGTC
TCCCAAGTCTTCAACCTGTTCAGAACGATGGGCCTGCGCCACCTGCCCGTGGTGAACGCT
GTGGGAGAGATCGTGGGGATCATCACACGGCACAACCTCACCTATGAATTTCTGCAGGCC
CGGCTGAGGCAGCACTACCAGACCATCTGA
Protein Properties
Number of Residues 869
Molecular Weight 97215.78
Theoretical pI 6.909
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Chloride transport protein 6
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDP
YLEVLETMDNKKGRRYEAVKWMVVFAIGVCTGLVGLFVDFFVRLFTQLKFGVVQTSVEEC
SQKGCLALSLLELLGFNLTFVFLASLLVLIEPVAAGSGIPEVKCYLNGVKVPGIVRLRTL
LCKVLGVLFSVAGGLFVGKEGPMIHSGSVVGAGLPQFQSISLRKIQFNFPYFRSDRDKRD
FVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKVLFCSMSATFTLNFFRSGIQF
GSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNCLNKRLAK
YRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSSSQIGNDSFQLQVTED
VNSSIKTFFCPNDTYNDMATLFFNPQESAILQLFHQDGTFSPVTLALFFVLYFLLACWTY
GISVPSGLFVPSLLCGAAFGRLVANVLKSYIGLGHIYSGTFALIGAAAFLGGVVRMTISL
TVILIESTNEITYGLPIMVTLMVAKWTGDFFNKGIYDIHVGLRGVPLLEWETEVEMDKLR
ASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFK
KSSILTRAGEQRKRSQSMKSYPSSELRNMCDEHIASEEPAEKEDLLQQMLERRYTPYPNL
YPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSESQSSASQPRLSYAEMAED
YPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNA
VGEIVGIITRHNLTYEFLQARLRQHYQTI
GenBank ID Protein 1263890
UniProtKB/Swiss-Prot ID P51797
UniProtKB/Swiss-Prot Entry Name CLCN6_HUMAN
PDB IDs Not Available
GenBank Gene ID X83378
GeneCard ID CLCN6
GenAtlas ID CLCN6
HGNC ID HGNC:2024
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1994;1(5):223-9. [PubMed:7584044 ]
  6. Lamb FS, Clayton GH, Liu BX, Smith RL, Barna TJ, Schutte BC: Expression of CLCN voltage-gated chloride channel genes in human blood vessels. J Mol Cell Cardiol. 1999 Mar;31(3):657-66. [PubMed:10198195 ]
  7. Brandt S, Jentsch TJ: ClC-6 and ClC-7 are two novel broadly expressed members of the CLC chloride channel family. FEBS Lett. 1995 Dec 11;377(1):15-20. [PubMed:8543009 ]
  8. Eggermont J, Buyse G, Voets T, Tytgat J, De Smedt H, Droogmans G, Nilius B: Alternative splicing of ClC-6 (a member of the CIC chloride-channel family) transcripts generates three truncated isoforms one of which, ClC-6c, is kidney-specific. Biochem J. 1997 Jul 1;325 ( Pt 1):269-76. [PubMed:9224655 ]
  9. Kornak U, Bosl MR, Kubisch C: Complete genomic structure of the CLCN6 and CLCN7 putative chloride channel genes(1). Biochim Biophys Acta. 1999 Oct 6;1447(1):100-6. [PubMed:10500249 ]
  10. Ignoul S, Simaels J, Hermans D, Annaert W, Eggermont J: Human ClC-6 is a late endosomal glycoprotein that associates with detergent-resistant lipid domains. PLoS One. 2007 May 30;2(5):e474. [PubMed:17534424 ]