You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08196
Secondary Accession Numbers
  • 13907
Name Beta-defensin 104
Synonyms
  1. BD-4
  2. Beta-defensin 4
  3. DEFB-4
  4. Defensin, beta 104
  5. hBD-4
Gene Name DEFB104A
Protein Type Unknown
Biological Properties
General Function Involved in defense response to bacterium
Specific Function Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:8
Locus 8p23.1
SNPs DEFB104A
Gene Sequence
>219 bp
ATGCAGAGACTTGTGCTGCTATTAGCCGTTTCTCTTCTACTCTATCAAGATCTTCCAGTG
AGAAGCGAATTTGAATTGGACAGAATATGTGGTTATGGGACTGCCCGTTGCCGGAAGAAA
TGTCGCAGCCAAGAATACAGAATTGGAAGATGTCCCAACACCTATGCATGCTGTTTGAGA
AAATGGGATGAGAGCTTACTGAATCGTACAAAACCCTGA
Protein Properties
Number of Residues 72
Molecular Weight 8525.9
Theoretical pI 9.4
Pfam Domain Function Not Available
Signals
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Beta-defensin 104
MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLR
KWDESLLNRTKP
GenBank ID Protein 17385081
UniProtKB/Swiss-Prot ID Q8WTQ1
UniProtKB/Swiss-Prot Entry Name D104A_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ314834
GeneCard ID DEFB104A
GenAtlas ID DEFB104A
HGNC ID HGNC:18115
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Garcia JR, Krause A, Schulz S, Rodriguez-Jimenez FJ, Kluver E, Adermann K, Forssmann U, Frimpong-Boateng A, Bals R, Forssmann WG: Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. FASEB J. 2001 Aug;15(10):1819-21. [PubMed:11481241 ]