You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08252
Secondary Accession Numbers
  • 13964
Name Lysyl oxidase homolog 4
Synonyms
  1. Lysyl oxidase-like protein 4
  2. Lysyl oxidase-related protein C
Gene Name LOXL4
Protein Type Unknown
Biological Properties
General Function Involved in copper ion binding
Specific Function May modulate the formation of a collagenous extracellular matrix
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
receptor activity
transmembrane receptor activity
scavenger receptor activity
oxidoreductase activity, acting on the ch-nh2 group of donors
oxidoreductase activity, acting on the ch-nh2 group of donors, oxygen as acceptor
molecular transducer activity
signal transducer activity
oxidoreductase activity
copper ion binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Secreted
  2. extracellular space (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 10q24
SNPs LOXL4
Gene Sequence
>2271 bp
ATGGCGTGGTCCCCACCAGCCACCCTCTTTCTGTTCCTGCTGCTGCTAGGCCAGCCCCCT
CCCAGCAGGCCACAGTCACTGGGCACCACTAAGCTCCGGCTGGTGGGCCCAGAGAGCAAG
CCAGAGGAGGGCCGCCTGGAGGTGCTGCACCAGGGCCAGTGGGGCACCGTGTGTGATGAC
AACTTTGCTATCCAGGAGGCCACAGTGGCTTGCCGCCAGCTGGGCTTCGAAGCTGCCTTG
ACCTGGGCCCACAGTGCCAAGTACGGCCAAGGGGAGGGACCCATCTGGCTGGACAATGTG
CGCTGTGTGGGCACAGAGAGCTCCTTGGACCAGTGCGGGTCTAATGGCTGGGGAGTCAGT
GACTGCAGTCACTCAGAAGACGTAGGGGTGATATGCCACCCCCGGCGCCATCGTGGCTAC
CTTTCTGAAACTGTCTCCAATGCCCTTGGGCCCCAGGGCCGGCGGCTGGAGGAGGTGCGG
CTCAAGCCCATCCTTGCCAGTGCCAAGCAGCATAGCCCAGTGACCGAGGGAGCCGTGGAG
GTGAAGTATGAGGGCCACTGGCGGCAGGTGTGTGACCAGGGCTGGACCATGAACAACAGC
AGGGTGGTGTGCGGGATGCTGGGCTTCCCCAGCGAGGTGCCTGTCGACAGCCACTACTAC
AGGAAAGTCTGGGATCTGAAGATGAGGGACCCTAAGTCTAGGCTGAAGAGCCTGACGAAT
AAGAACTCCTTCTGGATCCACCAGGTCACCTGCCTGGGGACAGAGCCCCACATGGCCAAC
TGCCAGGTGCAGGTGGCTCCAGCCCGGGGCAAGCTGCGGCCAGCCTGCCCAGGTGGCATG
CATGCTGTGGTCAGCTGTGTGGCAGGGCCTCACTTCCGCCCACCGAAGACAAAGCCACAA
CGCAAAGGGTCCTGGGCAGAGGAGCCGAGGGTGCGCCTGCGCTCCGGGGCCCAGGTGGGC
GAGGGCCGGGTGGAAGTGCTCATGAACCGCCAGTGGGGCACGGTCTGTGACCACAGGTGG
AACCTCATCTCTGCCAGTGTCGTGTGTCGTCAGCTGGGCTTTGGCTCTGCTCGGGAGGCC
CTCTTTGGGGCCCGGCTGGGCCAAGGGCTAGGGCCCATCCACCTGAGTGAGGTGCGCTGC
AGGGGATATGAGCGGACCCTCAGCGACTGCCCTGCCCTGGAAGGGTCCCAGAATGGTTGC
CAACATGAGAATGATGCTGCTGTCAGGTGCAATGTCCCTAACATGGGCTTTCAGAATCAG
GTGCGCTTGGCTGGTGGGCGTATCCCTGAGGAGGGGCTATTGGAGGTGCAGGTGGAGGTG
AACGGGGTCCCACGCTGGGGGAGCGTGTGCAGTGAAAACTGGGGGCTCACCGAAGCCATG
GTGGCCTGCCGACAGCTCGGCCTGGGTTTTGCCATCCATGCCTACAAGGAAACCTGGTTC
TGGTCGGGGACGCCAAGGGCCCAGGAGGTGGTGATGAGTGGGGTGCGCTGCTCAGGCACA
GAGCTGGCCCTGCAGCAGTGCCAGAGGCACGGGCCGGTGCACTGCTCCCACGGTGGCGGG
CGCTTCCTGGCTGGAGTCTCCTGCATGGACAGTGCACCAGACCTGGTGATGAACGCCCAG
CTAGTGCAGGAGACGGCCTACTTGGAGGACCGCCCGCTCAGCCAGCTGTATTGTGCCCAC
GAGGAGAACTGCCTCTCCAAGTCTGCGGATCACATGGACTGGCCCTACGGATACCGCCGC
CTATTGCGCTTCTCCACACAGATCTACAATCTGGGCCGGACTGACTTTCGTCCAAAGACT
GGACGCGATAGCTGGGTTTGGCACCAGTGCCACAGGCATTACCACAGCATTGAGGTCTTC
ACCCACTACGACCTCCTCACTCTCAATGGCTCCAAGGTGGCTGAGGGGCACAAGGCCAGC
TTCTGTCTGGAGGACACAAACTGCCCCACAGGACTGCAGCGGCGCTACGCATGTGCCAAC
TTTGGAGAACAGGGAGTGACTGTAGGCTGCTGGGACACCTACCGGCATGACATTGATTGC
CAGTGGGTGGATATCACAGATGTGGGCCCCGGGAATTATATCTTCCAGGTGATTGTGAAC
CCCCACTATGAAGTGGCAGAGTCAGATTTCTCCAACAATATGCTGCAGTGCCGCTGCAAG
TATGATGGGCACCGGGTCTGGCTGCACAACTGCCACACAGGGAATTCATACCCAGCCAAT
GCAGAACTCTCCCTGGAGCAGGAACAGCGTCTCAGGAACAACCTCATCTGA
Protein Properties
Number of Residues 756
Molecular Weight 84483.1
Theoretical pI 7.47
Pfam Domain Function
Signals
  • 1-24
Transmembrane Regions
  • None
Protein Sequence
>Lysyl oxidase homolog 4
MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDD
NFAIQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVS
DCSHSEDVGVICHPRRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVE
VKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWDLKMRDPKSRLKSLTN
KNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPHFRPPKTKPQ
RKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREA
LFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQ
VRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWF
WSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQ
LVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKT
GRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACAN
FGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCK
YDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI
GenBank ID Protein 14669471
UniProtKB/Swiss-Prot ID Q96JB6
UniProtKB/Swiss-Prot Entry Name LOXL4_HUMAN
PDB IDs Not Available
GenBank Gene ID AF338441
GeneCard ID LOXL4
GenAtlas ID LOXL4
HGNC ID HGNC:17171
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  5. Ito H, Akiyama H, Iguchi H, Iyama K, Miyamoto M, Ohsawa K, Nakamura T: Molecular cloning and biological activity of a novel lysyl oxidase-related gene expressed in cartilage. J Biol Chem. 2001 Jun 29;276(26):24023-9. Epub 2001 Apr 5. [PubMed:11292829 ]
  6. Maki JM, Tikkanen H, Kivirikko KI: Cloning and characterization of a fifth human lysyl oxidase isoenzyme: the third member of the lysyl oxidase-related subfamily with four scavenger receptor cysteine-rich domains. Matrix Biol. 2001 Nov;20(7):493-6. [PubMed:11691589 ]
  7. Asuncion L, Fogelgren B, Fong KS, Fong SF, Kim Y, Csiszar K: A novel human lysyl oxidase-like gene (LOXL4) on chromosome 10q24 has an altered scavenger receptor cysteine rich domain. Matrix Biol. 2001 Nov;20(7):487-91. [PubMed:11691588 ]