You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08273
Secondary Accession Numbers
  • 13985
Name Lysine-specific histone demethylase 1A
Synonyms
  1. BRAF35-HDAC complex protein BHC110
  2. Flavin-containing amine oxidase domain-containing protein 2
Gene Name KDM1A
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me. May play a role in the repression of neuronal genes. Alone, it is unable to demethylate H3K4me on nucleosomes and requires the presence of RCOR1/CoREST to achieve such activity. Also acts as a coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and mediating demethylation of H3K9me, a specific tag for epigenetic transcriptional repression. The presence of PRKCB in ANDR-containing complexes, which mediates phosphorylation of 'Thr- 6' of histone H3 (H3T6ph), a specific tag that prevents demethylation H3K4me, prevents H3K4me demethylase activity of KDM1A. Demethylates di-methylated 'Lys-370' of p53/TP53 which prevents interaction of p53/TP53 with TP53BP1 and represses p53/TP53-mediated transcriptional activation. Demethylates and stabilizes the DNA methylase DNMT1. Required for gastrulation during embryogenesis
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
oxidoreductase activity
fad or fadh2 binding
Process
metabolic process
macromolecule metabolic process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
post-translational protein modification
protein amino acid dealkylation
protein amino acid demethylation
histone demethylation
macromolecule modification
protein modification process
oxidation reduction
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.12
SNPs KDM1A
Gene Sequence
>2559 bp
ATGTTATCTGGGAAGAAGGCGGCAGCCGCGGCGGCGGCGGCTGCAGCGGCAGCAACCGGG
ACGGAGGCTGGCCCTGGGACAGCAGGCGGCTCCGAGAACGGGTCTGAGGTGGCCGCGCAG
CCCGCGGGCCTGTCGGGCCCAGCCGAGGTCGGGCCGGGGGCGGTGGGGGAGCGCACACCC
CGCAAGAAAGAGCCTCCGCGGGCCTCGCCCCCCGGGGGCCTGGCGGAACCGCCGGGGTCC
GCAGGGCCTCAGGCCGGCCCTACTGTCGTGCCTGGGTCTGCGACCCCCATGGAAACTGGA
ATAGCAGAGACTCCGGAGGGGCGTCGGACCAGCCGGCGCAAGCGGGCGAAGGTAGAGTAC
AGAGAGATGGATGAAAGCTTGGCCAACCTCTCAGAAGATGAGTATTATTCAGAAGAAGAG
AGAAATGCCAAAGCAGAGAAGGAAAAGAAGCTTCCCCCACCACCCCCTCAAGCCCCACCT
GAGGAAGAAAATGAAAGTGAGCCTGAAGAACCATCGGGTGTGGAGGGCGCAGCTTTCCAG
AGCCGACTTCCTCATGACCGGATGACTTCTCAAGAAGCAGCCTGTTTTCCAGATATTATC
AGTGGACCACAACAGACCCAGAAGGTTTTTCTTTTCATTAGAAACCGCACACTGCAGTTG
TGGTTGGATAATCCAAAGATTCAGCTGACATTTGAGGCTACTCTCCAACAATTAGAAGCA
CCTTATAACAGTGATACTGTGCTTGTCCACCGAGTTCACAGTTATTTAGAGCGTCATGGT
CTTATCAACTTCGGCATCTATAAGAGGATAAAACCCCTACCAACTAAAAAGACAGGAAAG
GTAATTATTATAGGCTCTGGGGTCTCAGGCTTGGCAGCAGCTCGACAGTTACAAAGTTTT
GGAATGGATGTCACACTTTTGGAAGCCAGGGATCGTGTGGGTGGACGAGTTGCCACATTT
CGCAAAGGAAACTATGTAGCTGATCTTGGAGCCATGGTGGTAACAGGTCTTGGAGGGAAT
CCTATGGCTGTGGTCAGCAAACAAGTAAATATGGAACTGGCCAAGATCAAGCAAAAATGC
CCACTTTATGAAGCCAACGGACAAGCTGTTCCTAAAGAGAAAGATGAAATGGTAGAGCAA
GAGTTTAACCGGTTGCTAGAAGCTACATCTTACCTTAGTCATCAACTAGACTTCAATGTC
CTCAATAATAAGCCTGTGTCCCTTGGCCAGGCATTGGAAGTTGTCATTCAGTTACAAGAG
AAGCATGTCAAAGATGAGCAGATTGAACATTGGAAGAAGATAGTGAAAACTCAGGAAGAA
TTGAAAGAACTTCTTAATAAGATGGTAAATTTGAAAGAGAAAATTAAAGAACTCCATCAG
CAATACAAAGAAGCATCTGAAGTAAAGCCACCCAGAGATATTACTGCCGAGTTCTTAGTG
AAAAGCAAACACAGGGATCTGACCGCCCTATGCAAGGAATATGATGAATTAGCTGAAACA
CAAGGAAAGCTAGAAGAAAAACTTCAGGAGTTGGAAGCGAATCCCCCAAGTGATGTATAT
CTCTCATCAAGAGACAGACAAATACTTGATTGGCATTTTGCAAATCTTGAATTTGCTAAT
GCCACACCTCTCTCAACTCTCTCCCTTAAGCACTGGGATCAGGATGATGACTTTGAGTTC
ACTGGCAGCCACCTGACAGTAAGGAATGGCTACTCGTGTGTGCCTGTGGCTTTAGCAGAA
GGCCTAGACATTAAACTGAATACAGCAGTGCGACAGGTTCGCTACACGGCTTCAGGATGT
GAAGTGATAGCTGTGAATACCCGCTCCACGAGTCAAACCTTTATTTATAAATGCGACGCA
GTTCTCTGTACCCTTCCCCTGGGTGTGCTGAAGCAGCAGCCACCAGCCGTTCAGTTTGTG
CCACCTCTCCCTGAGTGGAAAACATCTGCAGTCCAAAGGATGGGATTTGGCAACCTTAAC
AAGGTGGTGTTGTGTTTTGATCGGGTGTTCTGGGATCCAAGTGTCAATTTGTTCGGGCAT
GTTGGCAGTACGACTGCCAGCAGGGGTGAGCTCTTCCTCTTCTGGAACCTCTATAAAGCT
CCAATACTGTTGGCACTAGTGGCAGGAGAAGCTGCTGGTATCATGGAAAACATAAGTGAC
GATGTGATTGTTGGCCGATGCCTGGCCATTCTCAAAGGGATTTTTGGTAGCAGTGCAGTA
CCTCAGCCCAAAGAAACTGTGGTGTCTCGTTGGCGTGCTGATCCCTGGGCTCGGGGCTCT
TATTCCTATGTTGCTGCAGGATCATCTGGAAATGACTATGATTTAATGGCTCAGCCAATC
ACTCCTGGCCCCTCGATTCCAGGTGCCCCACAGCCGATTCCACGACTCTTCTTTGCGGGA
GAACATACGATCCGTAACTACCCAGCCACAGTGCATGGTGCTCTGCTGAGTGGGCTGCGA
GAAGCGGGAAGAATTGCAGACCAGTTTTTGGGGGCCATGTATACGCTGCCTCGCCAGGCC
ACACCAGGTGTTCCTGCACAGCAGTCCCCAAGCATGTGA
Protein Properties
Number of Residues 852
Molecular Weight 92901.9
Theoretical pI 6.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Lysine-specific histone demethylase 1A
MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQ
SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEA
PYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA
TPGVPAQQSPSM
GenBank ID Protein 58761546
UniProtKB/Swiss-Prot ID O60341
UniProtKB/Swiss-Prot Entry Name KDM1A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015013.3
GeneCard ID KDM1A
GenAtlas ID KDM1A
HGNC ID HGNC:29079
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  9. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  10. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581 ]
  11. Metzger E, Imhof A, Patel D, Kahl P, Hoffmeyer K, Friedrichs N, Muller JM, Greschik H, Kirfel J, Ji S, Kunowska N, Beisenherz-Huss C, Gunther T, Buettner R, Schule R: Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4. Nature. 2010 Apr 1;464(7289):792-6. doi: 10.1038/nature08839. Epub 2010 Mar 14. [PubMed:20228790 ]
  12. Humphrey GW, Wang Y, Russanova VR, Hirai T, Qin J, Nakatani Y, Howard BH: Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1. J Biol Chem. 2001 Mar 2;276(9):6817-24. Epub 2000 Dec 1. [PubMed:11102443 ]
  13. Hakimi MA, Dong Y, Lane WS, Speicher DW, Shiekhattar R: A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes. J Biol Chem. 2003 Feb 28;278(9):7234-9. Epub 2002 Dec 18. [PubMed:12493763 ]
  14. Huang J, Sengupta R, Espejo AB, Lee MG, Dorsey JA, Richter M, Opravil S, Shiekhattar R, Bedford MT, Jenuwein T, Berger SL: p53 is regulated by the lysine demethylase LSD1. Nature. 2007 Sep 6;449(7158):105-8. [PubMed:17805299 ]
  15. Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R: A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7420-5. [PubMed:12032298 ]
  16. Shi Y, Lan F, Matson C, Mulligan P, Whetstine JR, Cole PA, Casero RA, Shi Y: Histone demethylation mediated by the nuclear amine oxidase homolog LSD1. Cell. 2004 Dec 29;119(7):941-53. [PubMed:15620353 ]
  17. Forneris F, Binda C, Vanoni MA, Mattevi A, Battaglioli E: Histone demethylation catalysed by LSD1 is a flavin-dependent oxidative process. FEBS Lett. 2005 Apr 11;579(10):2203-7. [PubMed:15811342 ]
  18. Shi YJ, Matson C, Lan F, Iwase S, Baba T, Shi Y: Regulation of LSD1 histone demethylase activity by its associated factors. Mol Cell. 2005 Sep 16;19(6):857-64. [PubMed:16140033 ]
  19. Lee MG, Wynder C, Cooch N, Shiekhattar R: An essential role for CoREST in nucleosomal histone 3 lysine 4 demethylation. Nature. 2005 Sep 15;437(7057):432-5. Epub 2005 Aug 3. [PubMed:16079794 ]
  20. Metzger E, Wissmann M, Yin N, Muller JM, Schneider R, Peters AH, Gunther T, Buettner R, Schule R: LSD1 demethylates repressive histone marks to promote androgen-receptor-dependent transcription. Nature. 2005 Sep 15;437(7057):436-9. Epub 2005 Aug 3. [PubMed:16079795 ]
  21. Forneris F, Binda C, Vanoni MA, Battaglioli E, Mattevi A: Human histone demethylase LSD1 reads the histone code. J Biol Chem. 2005 Dec 16;280(50):41360-5. Epub 2005 Oct 13. [PubMed:16223729 ]
  22. Yang M, Gocke CB, Luo X, Borek D, Tomchick DR, Machius M, Otwinowski Z, Yu H: Structural basis for CoREST-dependent demethylation of nucleosomes by the human LSD1 histone demethylase. Mol Cell. 2006 Aug 4;23(3):377-87. [PubMed:16885027 ]
  23. Chen Y, Yang Y, Wang F, Wan K, Yamane K, Zhang Y, Lei M: Crystal structure of human histone lysine-specific demethylase 1 (LSD1). Proc Natl Acad Sci U S A. 2006 Sep 19;103(38):13956-61. Epub 2006 Sep 6. [PubMed:16956976 ]
  24. Tochio N, Umehara T, Koshiba S, Inoue M, Yabuki T, Aoki M, Seki E, Watanabe S, Tomo Y, Hanada M, Ikari M, Sato M, Terada T, Nagase T, Ohara O, Shirouzu M, Tanaka A, Kigawa T, Yokoyama S: Solution structure of the SWIRM domain of human histone demethylase LSD1. Structure. 2006 Mar;14(3):457-68. [PubMed:16531230 ]