You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08291
Secondary Accession Numbers
  • 14003
Name Sulfide:quinone oxidoreductase, mitochondrial
Synonyms Not Available
Gene Name SQRDL
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Catalyzes the oxidation of hydrogen sulfide, with the help of a quinone
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 15q15
SNPs SQRDL
Gene Sequence
>1353 bp
ATGGTGCCACTGGTGGCTGTGGTATCAGGGCCCCGTGCCCAGCTCTTTGCCTGCCTGCTC
AGGCTGGGCACTCAGCAGGTCGGCCCCCTTCAGCTGCACACCGGGGCCAGCCATGCGGCC
AGGAACCATTATGAGGTGCTGGTGCTGGGTGGGGGCAGTGGCGGAATCACCATGGCTGCC
CGCATGAAGAGGAAAGTGGGTGCAGAGAATGTGGCCATTGTTGAGCCCAGTGAGAGACAT
TTCTACCAGCCAATCTGGACACTGGTGGGTGCTGGTGCCAAACAATTGTCCTCATCTGGT
CGTCCCACGGCAAGTGTGATTCCATCTGGTGTAGAATGGATCAAAGCTAGAGTGACTGAG
TTGAACCCAGACAAGAACTGCATTCACACAGATGACGACGAGAAGATCTCCTACCGATAT
CTTATTATTGCTCTCGGAATCCAGCTGGACTATGAGAAGATTAAAGGCCTACCTGAAGGT
TTCGCTCATCCCAAAATAGGGTCGAATTATTCAGTTAAGACTGTAGAGAAGACATGGAAA
GCTCTGCAGGACTTCAAAGAGGGCAATGCCATCTTCACCTTCCCAAATACTCCAGTGAAG
TGTGCTGGAGCCCCTCAGAAGATCATGTACTTATCAGAAGCCTACTTCAGGAAGACAGGG
AAGCGATCCAAGGCCAATATCATTTTCAACACTTCTCTTGGAGCCATTTTCGGGGTTAAG
AAGTATGCAGATGCCCTGCAGGAGATCATCCAGGAGCGGAACCTCACTGTTAACTACAAG
AAAAACCTCATTGAAGTCCGAGCCGATAAACAAGAGGCTGTATTTGAGAACCTGGACAAA
CCAGGAGAGACCCAAGTGATTTCATATGAAATGCTTCATGTCACACCTCCAATGAGCCCA
CCAGATGTCCTCAAGACCAGTCCTGTGGCTGATGCTGCTGGTTGGGTGGATGTGGATAAA
GAAACTCTGCAACACAGGAGGTACCCAAATGTGTTTGGGATTGGGGACTGCACCAACCTT
CCTACGTCAAAGACCGCTGCTGCAGTAGCTGCCCAGTCAGGAATACTTGATAGGACAATT
TCTGTAATTATGAAGAATCAAACACCAACAAAGAAGTATGATGGCTACACATCATGTCCA
CTGGTGACCGGCTACAACCGTGTGATTCTTGCTGAGTTTGACTACAAAGCAGAGCCGCTA
GAAACCTTCCCCTTTGATCAAAGCAAAGAGCGCCTTTCCATGTATCTCATGAAAGCTGAC
CTGATGCCTTTCCTGTATTGGAATATGATGCTAAGGGGTTACTGGGGAGGACCAGCGTTT
CTGCGCAAGTTGTTTCATCTAGGTATGAGTTAA
Protein Properties
Number of Residues 450
Molecular Weight 49960.3
Theoretical pI 9.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Sulfide:quinone oxidoreductase, mitochondrial
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTE
LNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSP
PDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS
GenBank ID Protein 5256830
UniProtKB/Swiss-Prot ID Q9Y6N5
UniProtKB/Swiss-Prot Entry Name SQRD_HUMAN
PDB IDs Not Available
GenBank Gene ID AF042284
GeneCard ID SQRDL
GenAtlas ID SQRDL
HGNC ID HGNC:20390
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 2000 May;10(5):703-13. [PubMed:10810093 ]
  4. Vande Weghe JG, Ow DW: A fission yeast gene for mitochondrial sulfide oxidation. J Biol Chem. 1999 May 7;274(19):13250-7. [PubMed:10224084 ]