You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08300
Secondary Accession Numbers
  • 14012
Name ADP-ribosylation factor-like protein 2-binding protein
Synonyms
  1. ARF-like 2-binding protein
  2. Binder of ARF2 protein 1
Gene Name ARL2BP
Protein Type Unknown
Biological Properties
General Function Involved in small GTPase regulator activity
Specific Function May play a role as an effector of the ADP-ribosylation factor-like protein 2, ARL2
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Cytoplasm
  3. Mitochondrion intermembrane space
  4. cytoskeleton
  5. centrosome
Gene Properties
Chromosome Location Chromosome:1
Locus 16q13
SNPs ARL2BP
Gene Sequence
>492 bp
ATGGACGCCTTAGAAGGAGAGAGCTTTGCGCTGTCTTTCTCCTCCGCCTCTGATGCAGAA
TTTGATGCTGTGGTTGGATATTTAGAGGACATTATCATGGATGACGAGTTCCAGTTATTA
CAGAGAAATTTCATGGACAAGTACTACCTGGAGTTTGAAGACACAGAAGAGAATAAACTC
ATCTACACACCTATTTTTAATGAATACATTTCTTTGGTAGAAAAATACATTGAAGAACAG
CTGCTGCAGCGGATTCCTGAGTTCAACATGGCAGCCTTCACCACAACATTACAGCACCAT
AAGGATGAAGTGGCTGGTGACATATTCGACATGCTGCTCACCTTCACAGATTTTCTGGCT
TTTAAAGAAATGTTTTTGGACTACAGAGCAGAAAAAGAAGGCCGAGGACTGGACTTAAGC
AGTGGCTTAGTGGTGACTTCATTGTGCAAATCATCTTCTCTGCCAGCTTCCCAGAACAAT
CTGCGGCACTAG
Protein Properties
Number of Residues 163
Molecular Weight 18821.9
Theoretical pI 3.97
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>ADP-ribosylation factor-like protein 2-binding protein
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKL
IYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLA
FKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
GenBank ID Protein 4426962
UniProtKB/Swiss-Prot ID Q9Y2Y0
UniProtKB/Swiss-Prot Entry Name AR2BP_HUMAN
PDB IDs Not Available
GenBank Gene ID AF126062
GeneCard ID ARL2BP
GenAtlas ID ARL2BP
HGNC ID HGNC:17146
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  4. Sharer JD, Kahn RA: The ARF-like 2 (ARL2)-binding protein, BART. Purification, cloning, and initial characterization. J Biol Chem. 1999 Sep 24;274(39):27553-61. [PubMed:10488091 ]
  5. Van Valkenburgh H, Shern JF, Sharer JD, Zhu X, Kahn RA: ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins. J Biol Chem. 2001 Jun 22;276(25):22826-37. Epub 2001 Apr 12. [PubMed:11303027 ]
  6. Sharer JD, Shern JF, Van Valkenburgh H, Wallace DC, Kahn RA: ARL2 and BART enter mitochondria and bind the adenine nucleotide transporter. Mol Biol Cell. 2002 Jan;13(1):71-83. [PubMed:11809823 ]
  7. Zhou C, Cunningham L, Marcus AI, Li Y, Kahn RA: Arl2 and Arl3 regulate different microtubule-dependent processes. Mol Biol Cell. 2006 May;17(5):2476-87. Epub 2006 Mar 8. [PubMed:16525022 ]