Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.

Showing Protein ADP-ribosylation factor 6 (HMDBP08304)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP08304
Secondary Accession Numbers
  • 14016
Name ADP-ribosylation factor 6
Synonyms Not Available
Gene Name ARF6
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function GTP-binding protein involved in protein trafficking; regulates endocytic recycling and cytoskeleton remodeling. May modulate vesicle budding and uncoating within the Golgi apparatus. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Endosome membrane
  5. Golgi apparatus
Gene Properties
Chromosome Location Chromosome:1
Locus 14q21.3
SNPs ARF6
Gene Sequence 
>528 bp
ATGGGGAAGGTGCTATCCAAAATCTTCGGGAACAAGGAAATGCGGATCCTCATGTTGGGC
CTGGACGCGGCCGGCAAGACAACAATCCTGTACAAGTTGAAGCTGGGCCAGTCGGTGACC
ACCATTCCCACTGTGGGTTTCAACGTGGAGACGGTGACTTACAAAAATGTCAAGTTCAAC
GTATGGGATGTGGGCGGCCAGGACAAGATCCGGCCGCTCTGGCGGCATTACTACACTGGG
ACCCAAGGTCTCATCTTCGTAGTGGACTGCGCCGACCGCGACCGCATCGATGAGGCTCGC
CAGGAGCTGCACCGCATTATCAATGACCGGGAGATGAGGGACGCCATAATCCTCATCTTC
GCCAACAAGCAGGACCTGCCCGATGCCATGAAACCCCACGAGATCCAGGAGAAACTGGGC
CTGACCCGGATTCGGGACAGGAACTGGTATGTGCAGCCCTCCTGTGCCACCTCAGGGGAC
GGACTCTATGAGGGGCTCACATGGTTAACCTCTAACTACAAATCTTAA
Protein Properties
Number of Residues 175
Molecular Weight 20082.0
Theoretical pI 9.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>ADP-ribosylation factor 6
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P62330
UniProtKB/Swiss-Prot Entry Name ARF6_HUMAN
PDB IDs
GenBank Gene ID M57763
GeneCard ID ARF6
GenAtlas ID ARF6
HGNC ID HGNC:659
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mao M, Fu G, Wu JS, Zhang QH, Zhou J, Kan LX, Huang QH, He KL, Gu BW, Han ZG, Shen Y, Gu J, Yu YP, Xu SH, Wang YX, Chen SJ, Chen Z: Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning. Proc Natl Acad Sci U S A. 1998 Jul 7;95(14):8175-80. [PubMed:9653160 ]
  3. Haynes LP, Sherwood MW, Dolman NJ, Burgoyne RD: Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta. Traffic. 2007 Aug;8(8):1080-92. Epub 2007 Jun 6. [PubMed:17555535 ]
  4. Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V: ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma. J Cell Biol. 2003 Jul 7;162(1):113-24. [PubMed:12847086 ]
  5. Tsuchiya M, Price SR, Tsai SC, Moss J, Vaughan M: Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells. J Biol Chem. 1991 Feb 15;266(5):2772-7. [PubMed:1993656 ]
  6. Shiba T, Koga H, Shin HW, Kawasaki M, Kato R, Nakayama K, Wakatsuki S: Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proc Natl Acad Sci U S A. 2006 Oct 17;103(42):15416-21. Epub 2006 Oct 9. [PubMed:17030804 ]
  7. D'Souza-Schorey C, Stahl PD: Myristoylation is required for the intracellular localization and endocytic function of ARF6. Exp Cell Res. 1995 Nov;221(1):153-9. [PubMed:7589240 ]
  8. Martinu L, Masuda-Robens JM, Robertson SE, Santy LC, Casanova JE, Chou MM: The TBC (Tre-2/Bub2/Cdc16) domain protein TRE17 regulates plasma membrane-endosomal trafficking through activation of Arf6. Mol Cell Biol. 2004 Nov;24(22):9752-62. [PubMed:15509780 ]
  9. Fielding AB, Schonteich E, Matheson J, Wilson G, Yu X, Hickson GR, Srivastava S, Baldwin SA, Prekeris R, Gould GW: Rab11-FIP3 and FIP4 interact with Arf6 and the exocyst to control membrane traffic in cytokinesis. EMBO J. 2005 Oct 5;24(19):3389-99. Epub 2005 Sep 8. [PubMed:16148947 ]
  10. Garcia-Gonzalo FR, Bartrons R, Ventura F, Rosa JL: Requirement of phosphatidylinositol-4,5-bisphosphate for HERC1-mediated guanine nucleotide release from ARF proteins. FEBS Lett. 2005 Jan 17;579(2):343-8. [PubMed:15642342 ]
  11. Dubois T, Paleotti O, Mironov AA, Fraisier V, Stradal TE, De Matteis MA, Franco M, Chavrier P: Golgi-localized GAP for Cdc42 functions downstream of ARF1 to control Arp2/3 complex and F-actin dynamics. Nat Cell Biol. 2005 Apr;7(4):353-64. Epub 2005 Mar 27. [PubMed:15793564 ]
  12. Schonteich E, Pilli M, Simon GC, Matern HT, Junutula JR, Sentz D, Holmes RK, Prekeris R: Molecular characterization of Rab11-FIP3 binding to ARF GTPases. Eur J Cell Biol. 2007 Aug;86(8):417-31. Epub 2007 Jul 12. [PubMed:17628206 ]
  13. Pasqualato S, Menetrey J, Franco M, Cherfils J: The structural GDP/GTP cycle of human Arf6. EMBO Rep. 2001 Mar;2(3):234-8. [PubMed:11266366 ]