You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08331
Secondary Accession Numbers
  • 14043
Name Coatomer subunit beta
Synonyms
  1. Beta-COP
  2. Beta-coat protein
Gene Name COPB1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane coat
cell part
intracellular part
cytoplasm
macromolecular complex
protein complex
vesicle coat
copi vesicle coat
Function
binding
structural molecule activity
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Cytoplasmic vesicle
  6. Cytoplasmic side
  7. Cytoplasmic side
  8. COPI-coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.2
SNPs COPB1
Gene Sequence
>2862 bp
ATGACGGCGGCTGAGAACGTATGCTACACGTTAATTAACGTGCCAATGGATTCAGAACCA
CCATCTGAAATTAGCTTAAAAAATGATCTAGAAAAAGGAGATGTAAAGTCAAAGACTGAA
GCTTTGAAGAAAGTAATCATTATGATTCTGAATGGTGAAAAACTTCCTGGACTTCTGATG
ACCATCATTCGTTTTGTGCTACCTCTTCAGGATCACACTATCAAGAAATTACTTCTGGTA
TTTTGGGAAATTGTTCCTAAAACAACTCCAGATGGGAGACTTTTACATGAGATGATCCTT
GTATGTGATGCATACAGAAAGGATCTTCAACATCCTAATGAATTTATTCGAGGATCTACT
CTTCGTTTTCTTTGCAAATTGAAAGAAGCAGAATTGCTAGAACCTTTAATGCCAGCTATT
CGTGCATGTTTGGAGCATCGACACAGCTATGTTAGAAGAAATGCTGTTTTGGCCATCTAT
ACCATCTATAGAAATTTTGAACATCTTATACCTGATGCTCCTGAACTGATACATGATTTT
CTGGTGAATGAGAAGGATGCAAGTTGCAAAAGGAATGCATTTATGATGCTAATTCATGCA
GATCAGGATCGAGCTTTGGATTACTTAAGTACTTGCATTGATCAAGTTCAAACATTTGGA
GACATTCTGCAGCTGGTTATTGTTGAACTGATTTATAAGGTCTGTCATGCTAATCCATCA
GAAAGAGCTCGTTTTATTCGCTGCATCTATAACTTATTACAGTCATCCAGCCCTGCTGTA
AAATATGAAGCTGCTGGGACATTAGTGACACTCTCTAGTGCACCAACTGCAATCAAGGCT
GCTGCTCAGTGTTACATTGATTTAATTATTAAGGAGAGCGACAACAATGTAAAACTCATA
GTTTTGGATCGCTTGATAGAATTAAAAGAGCATCCTGCTCATGAACGAGTACTACAGGAT
CTGGTTATGGATATCCTAAGAGTATTGAGCACACCAGACTTAGAAGTACGAAAGAAAACT
CTGCAGTTAGCACTGGATCTTGTCTCTTCTAGAAATGTTGAAGAGCTGGTTATTGTCCTG
AAGAAGGAAGTGATTAAAACAAATAATGTGTCTGAGCATGAAGATACTGACAAATACAGA
CAACTCCTAGTGCGAACATTGCATTCCTGTTCTGTCCGATTTCCAGATATGGCTGCAAAT
GTTATTCCTGTGTTAATGGAATTTCTCAGTGACAACAACGAAGCAGCAGCTGCTGATGTC
TTGGAGTTTGTTCGTGAAGCCATTCAGCGCTTTGATAACCTGAGAATGCTTATTGTTGAG
AAGATGCTTGAAGTCTTTCATGCTATTAAATCTGTCAAGATTTACCGAGGAGCATTATGG
ATCCTGGGAGAATACTGTAGTACCAAGGAAGACATTCAGAGTGTGATGACTGAGATCCGC
AGGTCCCTTGGAGAGATCCCAATTGTAGAGTCAGAAATAAAGAAAGAAGCTGGTGAATTA
AAACCTGAAGAAGAAATAACTGTAGGGCCAGTTCAGAAATTGGTTACTGAAATGGGTACC
TATGCAACTCAGAGTGCCCTTAGCAGTTCTAGACCCACCAAGAAAGAGGAAGACAGACCT
CCCTTGAGAGGATTCCTTCTGGATGGAGATTTCTTTGTTGCTGCCTCCCTTGCCACAACT
CTGACCAAGATTGCATTGCGCTATGTAGCTTTGGTTCAGGAGAAGAAAAAGCAAAATTCT
TTTGTTGCTGAGGCTATGTTGCTCATGGCTACTATCCTGCATTTGGGAAAATCCTCTCTT
CCTAAGAAGCCAATTACTGATGATGATGTGGATCGAATTTCCCTGTGCCTCAAGGTCTTG
TCTGAATGTTCACCTTTAATGAATGACATTTTCAATAAGGAATGCAGACAGTCCCTTTCT
CACATGTTATCTGCTAAACTAGAAGAAGAGAAATTATCCCAAAAGAAAGAATCTGAAAAG
AGGAATGTGACAGTACAGCCTGATGACCCCATTTCCTTCATGCAACTAACTGCTAAGAAT
GAAATGAACTGCAAGGAAGATCAGTTTCAGCTGAGTTTACTGGCAGCAATGGGTAACACA
CAGAGGAAAGAGGCAGCAGATCCCCTAGCATCTAAACTTAACAAGGTCACCCAATTGACA
GGTTTCTCAGATCCTGTATATGCAGAAGCTTACGTTCATGTCAACCAATATGATATTGTC
CTGGATGTACTTGTTGTGAACCAAACCAGTGATACTTTGCAGAATTGCACATTAGAACTA
GCTACACTAGGGGATCTGAAACTTGTGGAAAAGCCGTCTCCTTTGACTCTTGCTCCTCAT
GACTTCGCAAATATTAAAGCTAACGTCAAAGTAGCATCAACAGAAAATGGAATAATTTTT
GGTAATATAGTTTATGATGTCTCTGGAGCAGCAAGTGACAGAAATTGTGTGGTCCTCAGT
GATATTCACATCGAAATCATGGACTATATCCAGCCTGCAACTTGCACTGATGCAGAATTC
CGTCAGATGTGGGCCGAATTGGAATGGGAAAACAAAGTGACAGTTAACACCAACATGGTT
GATTTAAATGACTACTTACAGCACATATTAAAGTCAACCAATATGAAATGCCTGACTCCA
GAAAAGGCCCTTTCTGGTTACTGTGGCTTTATGGCAGCCAACCTTTATGCTCGCTCCATA
TTTGGTGAAGATGCACTTGCAAATGTCAGCAGTGAGAAGCCATTACACCAGGGACCAGAT
GCTGCTGTTACCGTCCATATAAGAATTCGTGCAAAGAGCCAGGGAATGGCCTTAAGTCTT
GGAGATAAAATCAACTTGTCACAGAAGGAAACTAGTATATAA
Protein Properties
Number of Residues 953
Molecular Weight 107141.1
Theoretical pI 5.92
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Coatomer subunit beta
MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM
TIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGST
LRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDF
LVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPS
ERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLI
VLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVL
KKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDNNEAAAADV
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIR
RSLGEIPIVESEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRP
PLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSL
PKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEK
RNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLT
GFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPH
DFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF
RQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSI
FGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
GenBank ID Protein 5257007
UniProtKB/Swiss-Prot ID P53618
UniProtKB/Swiss-Prot Entry Name COPB_HUMAN
PDB IDs Not Available
GenBank Gene ID AF084457
GeneCard ID COPB1
GenAtlas ID COPB1
HGNC ID HGNC:2231
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  3. Benichou S, Bomsel M, Bodeus M, Durand H, Doute M, Letourneur F, Camonis J, Benarous R: Physical interaction of the HIV-1 Nef protein with beta-COP, a component of non-clathrin-coated vesicles essential for membrane traffic. J Biol Chem. 1994 Dec 2;269(48):30073-6. [PubMed:7982906 ]
  4. Burman JL, Bourbonniere L, Philie J, Stroh T, Dejgaard SY, Presley JF, McPherson PS: Scyl1, mutated in a recessive form of spinocerebellar neurodegeneration, regulates COPI-mediated retrograde traffic. J Biol Chem. 2008 Aug 15;283(33):22774-86. doi: 10.1074/jbc.M801869200. Epub 2008 Jun 13. [PubMed:18556652 ]