You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08334
Secondary Accession Numbers
  • 14046
Name Coatomer subunit gamma-2
Synonyms
  1. Gamma-2-COP
  2. Gamma-2-coat protein
Gene Name COPG2
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
membrane coat
macromolecular complex
protein complex
organelle
vesicle coat
copi vesicle coat
golgi-associated vesicle
vesicle
Function
binding
structural molecule activity
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Cytoplasmic vesicle
  6. Cytoplasmic side
  7. Cytoplasmic side
  8. COPI-coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:7
Locus 7q32
SNPs COPG2
Gene Sequence
>2616 bp
ATGATTAAAAAATTCGACAAGAAGGACGAGGAGTCTGGTAGTGGCTCCAATCCTTTCCAG
CATCTGGAGAAGAGTGCTGTTTTACAGGAGGCTCGTATATTCAATGAAACTCCAATCAAT
CCAAGAAGATGTTTGCATATTCTTACAAAGATTCTTTACTTACTGAACCAGGGTGAACAC
TTTGGAACAACGGAAGCTACAGAAGCCTTCTTTGCAATGACGCGATTGTTTCAATCTAAT
GATCAAACATTGAGGAGAATGTGCTACCTTACCATCAAAGAAATGGCTACCATCTCTGAG
GATGTGATAATTGTCACAAGCAGTCTGACTAAAGACATGACTGGAAAAGAAGATGTATAC
CGAGGCCCGGCCATCAGAGCTCTCTGCAGGATCACCGATGGAACAATGTTGCAAGCCATT
GAAAGATACATGAAGCAGGCCATTGTGGATAAAGTTTCCAGTGTATCCAGTTCAGCACTG
GTATCTTCCCTGCACATGATGAAGATAAGCTATGATGTGGTTAAGCGCTGGATCAATGAA
GCCCAAGAAGCTGCATCAAGTGATAATATTATGGTCCAGTACCATGCATTGGGAGTCCTG
TATCACCTTAGAAAGAATGATCGACTTGCTGTTTCCAAGATGTTGAATAAGTTTACTAAA
TCTGGTCTCAAGTCACAGTTTGCTTACTGCATGCTGATCCGAATTGCCAGTCGCTTACTA
AAAGAAACTGAGGATGGCCATGAAAGTCCACTGTTTGATTTCATTGAGAGCTGCTTGCGA
AATAAACATGAAATGGTTATTTATGAAGCTGCTTCAGCTATCATCCATCTTCCTAACTGC
ACTGCAAGAGAGTTGGCACCTGCTGTTTCAGTTCTTCAACTTTTCTGTAGTTCTCCTAAG
CCAGCCTTGAGATATGCAGCTGTGAGGACCTTGAACAAGGTGGCAATGAAGCACCCCTCT
GCTGTTACTGCCTGCAATCTGGACTTAGAAAACTTAATCACAGACTCAAACAGAAGCATT
GCTACCTTAGCCATTACTACACTCCTCAAAACAGGAAGTGAGAGCAGTGTGGACCGGCTC
ATGAAGCAGATATCTTCTTTTGTGTCTGAAATCTCAGATGAGTTCAAGGTGGTGGTTGTA
CAGGCAATTAGTGCTCTCTGTCAGAAATACCCTCGAAAGCACAGTGTCATGATGACTTTC
CTCTCCAACATGCTCCGAGATGATGGAGGCTTTGAGTACAAGCGGGCCATTGTGGACTGT
ATAATCAGCATTGTGGAAGAGAACCCTGAGAGTAAAGAAGCAGGCCTAGCCCACCTTTGT
GAATTCATTGAGGACTGTGAACACACTGTTCTGGCTACTAAGATTCTACACTTGTTGGGC
AAAGAGGGCCCTAGAACGCCTGTCCCCTCCAAATATATCCGTTTTATTTTTAATAGGGTT
GTCCTGGAGAATGAGGCTGTCAGAGCTGCTGCTGTGAGTGCTTTGGCTAAATTTGGGGCT
CAGAATGAGAGTCTTCTCCCAAGCATCCTTGTACTCTTACAGAGGTGTATGATGGATACT
GATGACGAGGTACGAGACAGAGCTACCTTCTATCTGAATGTGCTGCAGCAGAGGCAGATG
GCACTAAATGCCACATATATCTTTAATGGTTTGACGGTCTCTGTACCAGGGATGGAAAAA
GCCTTACACCAGTACACGTTGGAGCCTTCAGAAAAACCGTTTGACATGAAATCAATTCCT
CTTGCTATGGCTCCTGTCTTTGAACAGAAAGCAGAAATCACACTTGTGGCTACTAAGCCA
GAGAAGTTGGCTCCTTCCAGGCAAGACATTTTCCAAGAACAATTGGCTGCCATTCCTGAG
TTTCTGAATATAGGACCCTTGTTCAAGTCTTCTGAGCCTGTTCAACTTACAGAAGCAGAG
ACAGAATATTTTGTTCGATGTATCAAGCACATGTTTACCAATCACATCGTGTTCCAGTTT
GACTGCACCAACACTCTCAATGACCAGCTGCTGGAAAAAGTGACAGTGCAGATGGAGCCA
TCAGATTCCTATGAAGTGCTGTCTTGTATCCCAGCCCCCAGCCTTCCTTATAACCAACCA
GGAATATGTTACACTCTTGTTCGTTTGCCTGATGATGACCCTACAGCAGTTGCAGGCTCC
TTTAGCTGCACCATGAAGTTTACAGTCCGGGACTGTGACCCTAACACTGGAGTTCCAGAT
GAGGATGGGTATGATGATGAGTATGTGCTGGAAGATCTCGAAGTGACTGTGTCTGACCAT
ATTCAGAAAGTACTGAAGCCTAACTTTGCTGCTGCTTGGGAAGAGGTGGGAGATACCTTT
GAGAAAGAGGAAACCTTTGCCCTCAGTTCTACCAAAACCCTTGAAGAGGCTGTCAACAAT
ATCATCACATTTCTGGGCATGCAGCCATGTGAGAGGTCCGATAAAGTACCTGAGAACAAG
AATTCCCATTCGCTCTATCTGGCAGGTATATTCAGAGGTGGCTATGATTTATTGGTGAGG
TCCAGGCTGGCCTTAGCCGATGGAGTGACCATGCAGGTGACTGTCAGAAGTAAAGAGAGA
ACACCTGTAGATGTTATCTTAGCTTCTGTTGGATAA
Protein Properties
Number of Residues 871
Molecular Weight 97621.3
Theoretical pI 5.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Coatomer subunit gamma-2
MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEH
FGTTEATEAFFAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVY
RGPAIRALCRITDGTMLQAIERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINE
AQEAASSDNIMVQYHALGVLYHLRKNDRLAVSKMLNKFTKSGLKSQFAYCMLIRIASRLL
KETEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNCTARELAPAVSVLQLFCSSPK
PALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGSESSVDRL
MKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDC
IISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRV
VLENEAVRAAAVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQM
ALNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKP
EKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQF
DCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGS
FSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTF
EKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVR
SRLALADGVTMQVTVRSKERTPVDVILASVG
GenBank ID Protein 11094285
UniProtKB/Swiss-Prot ID Q9UBF2
UniProtKB/Swiss-Prot Entry Name COPG2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB047847
GeneCard ID COPG2
GenAtlas ID COPG2
HGNC ID HGNC:2237
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  4. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  5. Blagitko N, Schulz U, Schinzel AA, Ropers HH, Kalscheuer VM: gamma2-COP, a novel imprinted gene on chromosome 7q32, defines a new imprinting cluster in the human genome. Hum Mol Genet. 1999 Dec;8(13):2387-96. [PubMed:10556286 ]
  6. Futatsumori M, Kasai K, Takatsu H, Shin HW, Nakayama K: Identification and characterization of novel isoforms of COP I subunits. J Biochem. 2000 Nov;128(5):793-801. [PubMed:11056392 ]