Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08344
Secondary Accession Numbers
  • 14056
Name Protein diaphanous homolog 1
Synonyms
  1. DRF1
  2. Diaphanous-related formin-1
Gene Name DIAPH1
Protein Type Unknown
Biological Properties
General Function Involved in actin binding
Specific Function Acts in a Rho-dependent manner to recruit PFY1 to the membrane. Required for the assembly of F-actin structures, such as actin cables and stress fibers. Nucleates actin filaments. Binds to the barbed end of the actin filament and slows down actin polymerization and depolymerization. Required for cytokinesis, and transcriptional activation of the serum response factor. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics. Functions as a scaffold protein for MAPRE1 and APC to stabilize microtubules and promote cell migration. Has neurite outgrowth promoting activity. In hear cells, it may play a role in the regulation of actin polymerization in hair cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
cytoskeletal protein binding
actin binding
gtpase binding
small gtpase binding
ras gtpase binding
rho gtpase binding
enzyme binding
Process
cytoskeleton organization
actin cytoskeleton organization
cellular process
cellular component organization at cellular level
organelle organization
cellular component organization or biogenesis
cellular component organization
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. cytoskeleton
  4. Cell projection
  5. ruffle membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31
SNPs DIAPH1
Gene Sequence
>3819 bp
ATGGAGCCGCCCGGCGGGAGCCTGGGGCCCGGCCGCGGGACCCGGGACAAGAAGAAGGGC
CGGAGCCCAGATGAGCTGCCCTCGGCGGGCGGCGACGGCGGCAAATCTAAGAAATTTACT
CTGAAGCGGCTCATGGCAGATGAGCTGGAGAGATTTACCAGCATGAGAATTAAGAAGGAG
AAGGAAAAGCCCAATTCTGCTCATAGAAATTCTTCTGCATCATATGGGGATGATCCCACA
GCACAGTCATTGCAAGATGTTTCAGATGAACAAGTGCTGGTTCTCTTTGAACAGATGCTG
CTGGATATGAACCTGAATGAGGAGAAACAGCAACCTTTGAGGGAGAAGGACATCATCATC
AAGAGGGAGATGGTGTCCCAATACTTGTACACCTCCAAGGCTGGCATGAGCCAGAAGGAG
AGCTCTAAGTCTGCCATGATGTATATTCAGGAGTTGAGGTCAGGCTTGCGGGATATGCCT
CTGCTCAGCTGCCTGGAGTCCCTTCGTGTGTCTCTCAACAACAACCCTGTCAGTTGGGTG
CAAACATTTGGTGCTGAAGGCTTGGCCTCCTTATTGGACATTCTTAAACGACTTCATGAT
GAGAAAGAAGAGACTGCTGGGAGTTACGATAGCCGGAACAAGCATGAGATCATTCGCTGC
TTGAAAGCTTTTATGAACAACAAGTTTGGAATCAAGACCATGTTGGAGACAGAAGAAGGA
ATCCTACTGCTGGTCAGAGCCATGGATCCTGCTGTTCCCAACATGATGATTGATGCAGCT
AAGCTGCTTTCTGCTCTTTGTATTCTACCGCAGCCAGAGGACATGAATGAAAGGGTTTTG
GAGGCAATGACAGAAAGAGCTGAGATGGATGAAGTGGAACGTTTCCAGCCGCTGCTGGAT
GGATTAAAAAGTGGAACCACTATTGCACTGAAGGTTGGATGCCTACAGCTGATCAATGCT
CTCATCACACCAGCGGAGGAACTTGACTTCCGAGTTCACATCAGAAGTGAACTGATGCGT
TTGGGGCTACATCAGGTGTTGCAGGACCTTCGAGAGATTGAAAATGAAGATATGAGAGTG
CAACTAAATGTGTTTGATGAACAAGGGGAAGAGGATTCCTATGACCTGAAGGGACGGCTG
GATGACATTCGCATGGAGATGGATGACTTTAATGAAGTCTTTCAGATTCTCTTAAACACA
GTGAAGGATTCAAAGGCAGAGCCACACTTCCTTTCCATCCTGCAGCACTTACTCTTGGTC
CGAAATGACTATGAGGCCAGACCTCAGTACTATAAGTTGATTGAAGAATGTATTTCCCAG
ATAGTTCTGCACAAGAACGGGGCTGATCCTGACTTCAAGTGCCGGCACCTCCAGATTGAG
ATTGAGGGATTAATTGATCAAATGATTGATAAGACAAAGGTGGAGAAATCTGAAGCCAAA
GCTGCAGAGCTGGAAAAGAAGTTGGACTCAGAGTTAACAGCCCGACATGAGCTACAGGTG
GAAATGAAAAAGATGGAAAGTGACTTTGAGCAGAAGCTTCAAGATCTTCAGGGAGAAAAA
GATGCACTGCATTCTGAAAAGCAGCAAATTGCCACAGAGAAACAGGACCTGGAAGCAGAG
GTGTCCCAGCTCACAGGAGAGGTTGCCAAGCTGACAAAGGAACTGGAAGATGCCAAGAAA
GAAATGGCTTCCCTCTCTGCGGCAGCTATTACTGTACCTCCTTCTGTTCCTAGTCGTGCT
CCTGTTCCCCCTGCCCCTCCTTTACCTGGTGACTCTGGCACTATTATTCCACCACCACCT
GCTCCTGGGGATAGTACCACTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCACCTCCT
TTGCCTGGGGGTGTTTGCATCTCCTCACCCCCTTCTTTACCTGGAGGTACTGCTATCTCT
CCACCCCCTCCTTTGTCTGGGGATGCTACCATCCCTCCACCCCCTCCTTTGCCTGAGGGT
GTTGGCATCCCTTCACCCTCTTCTTTGCCTGGAGGTACTGCCATCCCCCCACCTCCTCCT
TTGCCTGGGAGTGCTAGAATCCCCCCACCACCACCTCCTTTGCCTGGGAGTGCTGGAATT
CCCCCCCCACCTCCTCCCTTGCCTGGAGAAGCAGGAATGCCACCTCCTCCTCCCCCTCTT
CCTGGTGGTCCTGGAATCCCTCCACCTCCTCCATTTCCCGGAGGCCCTGGCATTCCTCCA
CCTCCACCCGGAATGGGTATGCCTCCACCTCCCCCATTTGGATTTGGAGTTCCTGCAGCC
CCAGTTCTGCCATTTGGATTAACCCCCAAAAAGCTTTATAAGCCAGAGGTGCAGCTCCGG
AGGCCAAACTGGTCCAAGCTTGTGGCTGAGGACCTCTCCCAGGACTGCTTCTGGACAAAG
GTGAAGGAGGACCGCTTTGAGAACAATGAACTTTTCGCCAAACTTACCCTTACCTTCTCT
GCCCAGACCAAGACTTCCAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCT
GTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTC
TCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAG
CCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCA
GAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTC
ACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACC
TTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTA
CACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAG
CTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACA
GATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACAG
TATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAAT
TTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAA
AAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGAC
AGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAA
GCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATC
CTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAA
Protein Properties
Number of Residues 1272
Molecular Weight 141346.0
Theoretical pI 5.07
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein diaphanous homolog 1
MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLD
GLKSGTTIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRV
QLNVFDEQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAK
AAELEKKLDSELTARHELQVEMKKMESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAE
VSQLTGEVAKLTKELEDAKKEMASLSAAAITVPPSVPSRAPVPPAPPLPGDSGTIIPPPP
APGDSTTPPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEG
VGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPL
PGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPEVQLR
RPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKS
VQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPE
PEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSV
TAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLL
HFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAAT
DEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHN
FRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMD
SLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTI
LEEAKELVGRAS
GenBank ID Protein 119395758
UniProtKB/Swiss-Prot ID O60610
UniProtKB/Swiss-Prot Entry Name DIAP1_HUMAN
PDB IDs
GenBank Gene ID NM_005219.4
GeneCard ID DIAPH1
GenAtlas ID DIAPH1
HGNC ID HGNC:2876
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  8. Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D: Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. Proteomics. 2007 Mar;7(6):868-74. [PubMed:17370265 ]
  9. Reinhard M, Giehl K, Abel K, Haffner C, Jarchau T, Hoppe V, Jockusch BM, Walter U: The proline-rich focal adhesion and microfilament protein VASP is a ligand for profilins. EMBO J. 1995 Apr 18;14(8):1583-9. [PubMed:7737110 ]
  10. Lynch ED, Lee MK, Morrow JE, Welcsh PL, Leon PE, King MC: Nonsyndromic deafness DFNA1 associated with mutation of a human homolog of the Drosophila gene diaphanous. Science. 1997 Nov 14;278(5341):1315-8. [PubMed:9360932 ]
  11. Morita K, Lo Celso C, Spencer-Dene B, Zouboulis CC, Watt FM: HAN11 binds mDia1 and controls GLI1 transcriptional activity. J Dermatol Sci. 2006 Oct;44(1):11-20. Epub 2006 Aug 2. [PubMed:16887337 ]