You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08345
Secondary Accession Numbers
  • 14057
Name Protein diaphanous homolog 2
Synonyms
  1. DRF2
  2. Diaphanous-related formin-2
Gene Name DIAPH2
Protein Type Unknown
Biological Properties
General Function Involved in actin binding
Specific Function Could be involved in oogenesis. Involved in the regulation of endosome dynamics. Implicated in a novel signal transduction pathway, in which isoform 3 and CSK are sequentially activated by RHOD to regulate the motility of early endosomes through interactions with the actin cytoskeleton
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
cytoskeletal protein binding
actin binding
gtpase binding
small gtpase binding
ras gtpase binding
rho gtpase binding
enzyme binding
Process
cytoskeleton organization
actin cytoskeleton organization
cellular process
cellular component organization at cellular level
organelle organization
cellular component organization or biogenesis
cellular component organization
Cellular Location
  1. cytosol
  2. Isoform 3:Cytoplasm
  3. Early endosome
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs DIAPH2
Gene Sequence
>3306 bp
ATGGAGCAGCCCGGGGCGGCGGCGTCGGGAGCGGGAGGCGGCAGCGAGGAACCCGGTGGG
GGCCGGAGCAACAAGCGGAGCGCGGGGAACCGGGCCGCCAATGAAGAGGAAACGAAAAAC
AAACCCAAATTGAACATTCAAATAAAAACTTTGGCAGATGATGTGCGTGACCGAATTACA
AGTTTTAGAAAATCTACTGTCAAAAAAGAAAAACCTCTTATTCAACATCCTATTGATTCT
CAAGTCGCGATGAGTGAGTTTCCTGCAGCTCAGCCATTATATGATGAACGATCTTTGAAT
TTGTCAGAAAAGGAAGTATTGGATCTCTTTGAAAAAATGATGGAGGACATGAACCTTAAC
GAAGAGAAAAAAGCTCCTTTACGAAACAAAGACTTTACCACCAAACGTGAGATGGTTGTC
CAGTATATTTCTGCCACTGCCAAATCTGGTGGGCTGAAAAACAGCAAACATGAATGCACC
CTGTCTTCACAAGAATATGTTCATGAATTACGATCGGGTATATCAGATGAGAAACTTCTT
AATTGCCTAGAATCCCTCAGGGTTTCTTTAACCAGCAATCCGGTCAGCTGGGTTAACAAC
TTTGGCCATGAAGGTCTTGGACTCTTATTGGATGAGCTGGAAAAGCTTCTGGACAAAAAA
CAGCAAGAAAATATTGACAAGAAGAATCAGTATAAACTTATTCAATGCCTCAAAGCATTT
ATGAATAATAAGTTTGGATTACAAAGGATTCTAGGAGATGAAAGAAGTCTTTTACTATTG
GCAAGAGCAATTGACCCCAAACAACCCAACATGATGACTGAAATAGTAAAAATACTTTCT
GCTATTTGCATTGTTGGAGAAGAGAACATTCTAGATAAACTTTTAGGGGCTATAACAACA
GCAGCAGAAAGAAATAACAGGGAACGATTTTCACCAATTGTGGAAGGTTTAGAAAATCAG
GAAGCCTTGCAATTACAGGTGGCCTGCATGCAGTTTATAAATGCCCTTGTCACTTCTCCT
TATGAGCTTGATTTTCGAATACATTTAAGGAATGAATTCCTCCGTTCAGGACTAAAAACA
ATGTTACCAGATCTAAAAGAAAAAGAGAATGATGAGCTTGATATTCAGTTGAAAGTATTT
GATGAAAACAAAGAAGATGACCTAACTGAATTATCACACCGTCTCAATGACATTCGAGCA
GAAATGGATGATATGAATGAAGTCTACCATCTTCTATATAATATGCTGAAGGACACTGCT
GCTGAAAATTACTTCTTATCTATTCTACAACATTTTTTGCTTATCAGAAATGATTATTAT
ATCAGGCCACAATATTATAAAATAATTGAGGAATGTGTTTCACAGATAGTGCTACACTGC
AGTGGTATGGATCCAGACTTCAAATACAGGCAAAGATTAGACATCGATTTAACTCATCTG
ATAGATTCTTGTGTGAACAAGGCGAAAGTTGAAGAAAGTGAACAAAAAGCTGCAGAGTTT
TCAAAGAAGTTCGATGAAGAATTCACAGCTCGACAGGAAGCTCAAGCAGAGCTTCAAAAA
AGAGATGAGAAAATCAAAGAACTTGAAGCAGAAATCCAGCAACTTCGAACCCAGGCACAA
GTACTCTCAAGTTCATCAGGAATTCCAGGTCCTCCTGCAGCACCTCCATTGCCAGGTGTA
GGGCCGCCTCCACCACCACCCGCGCCACCTCTACCCGGAGGAGCTCCTCTTCCTCCTCCA
CCACCTCCTTTACCTGGAATGATGGGGATACCACCACCACCCCCACCACCACTTTTATTT
GGGGGACCTCCTCCACCACCACCCCTTGGAGGAGTTCCTCCTCCCCCAGGAATATCACTT
AATCTACCTTATGGAATGAAGCAGAAAAAAATGTATAAACCTGAAGTGTCCATGAAGAGA
ATCAATTGGTCAAAGATTGAACCCACAGAATTATCTGAGAACTGTTTCTGGTTAAGAGTC
AAAGAAGACAAGTTTGAGAATCCAGATCTCTTTGCCAAATTGGCATTGAATTTTGCTACT
CAGATAAAAGTTCAAAAGAACGCAGAAGCATTAGAAGAAAAGAAGACTGGGCCTACAAAG
AAGAAAGTGAAAGAACTGAGAATTTTGGATCCCAAAACAGCTCAGAATCTGTCCATCTTT
CTGGGATCATATCGCATGCCATATGAAGACATAAGAAACGTTATTCTGGAGGTTAATGAA
GACATGCTGAGTGAGGCTTTAATTCAGAACCTTGTGAAACATCTTCCTGAGCAGAAGATA
CTCAACGAATTAGCAGAGCTTAAGAATGAATATGATGACCTCTGTGAGCCTGAACAATTT
GGAGTTGTGATGAGCTCTGTGAAAATGTTACAGCCTCGTCTCAGTAGTATCCTGTTCAAG
CTCACATTTGAAGAACACATAAACAACATCAAACCAAGCATCATAGCAGTAACTCTTGCC
TGTGAAGAACTGAAGAAAAGTGAAAGCTTTAACAGACTTTTAGAGTTAGTTCTTCTTGTT
GGAAACTACATGAACTCAGGCTCAAGAAATGCCCAGTCTTTGGGATTTAAGATCAACTTC
CTTTGTAAGATCAGAGATACTAAATCAGCGGATCAAAAAACAACCCTTTTGCATTTTATT
GCCGACATTTGTGAGGAAAAATATCGAGATATCCTAAAATTTCCTGAAGAACTGGAACAC
GTAGAAAGTGCAAGCAAAGTTTCAGCTCAAATTCTCAAGAGCAACCTTGCATCAATGGAA
CAACAAATTGTTCATCTGGAACGTGACATCAAGAAATTCCCCCAAGCAGAAAATCAACAC
GATAAGTTTGTGGAAAAGATGACCAGCTTTACAAAGACTGCCCGAGAACAGTATGAAAAA
CTCTCCACCATGCACAACAACATGATGAAGCTCTATGAGAATCTTGGAGAATACTTCATT
TTTGACTCAAAGACAGTGAGCATAGAAGAGTTCTTTGGTGATCTCAACAACTTCCGAACT
TTGTTTTTGGAAGCAGTGAGAGAAAACAATAAGAGAAGAGAAATGGAAGAGAAGACCAGG
AGGGCAAAACTTGCAAAAGAGAAAGCTGAACAAGAAAAGTTAGAACGCCAGAAGAAAAAG
AAACAACTCATTGATATAAACAAAGAGGGTGATGAGACTGGTGTGATGGATAATCTTCTA
GAAGCCCTACAATCAGGTGCAGCATTCAGAGACCGTCGAAAGCGGATTCCAAGGAATCCA
GATAACAGACGAGTACCTTTGGAAAGGTCACGCTCTCGCCACAATGGAGCTATCTCATCT
AAGTGA
Protein Properties
Number of Residues 1101
Molecular Weight 125568.0
Theoretical pI 6.54
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein diaphanous homolog 2
MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRIT
SFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
EEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDEKLL
NCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAF
MNNKFGLQRILGDERSLLLLARAIDPKQPNMMTEIVKILSAICIVGEENILDKLLGAITT
AAERNNRERFSPIVEGLENQEALQLQVACMQFINALVTSPYELDFRIHLRNEFLRSGLKT
MLPDLKEKENDELDIQLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTA
AENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLHCSGMDPDFKYRQRLDIDLTHL
IDSCVNKAKVEESEQKAAEFSKKFDEEFTARQEAQAELQKRDEKIKELEAEIQQLRTQAQ
VLSSSSGIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLF
GGPPPPPPLGGVPPPPGISLNLPYGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRV
KEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIF
LGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQF
GVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLV
GNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEH
VESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEK
LSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTR
RAKLAKEKAEQEKLERQKKKKQLIDINKEGDETGVMDNLLEALQSGAAFRDRRKRIPRNP
DNRRVPLERSRSRHNGAISSK
GenBank ID Protein 57208221
UniProtKB/Swiss-Prot ID O60879
UniProtKB/Swiss-Prot Entry Name DIAP2_HUMAN
PDB IDs Not Available
GenBank Gene ID AL031053
GeneCard ID DIAPH2
GenAtlas ID DIAPH2
HGNC ID HGNC:2877
References
General References
  1. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  4. Bione S, Sala C, Manzini C, Arrigo G, Zuffardi O, Banfi S, Borsani G, Jonveaux P, Philippe C, Zuccotti M, Ballabio A, Toniolo D: A human homologue of the Drosophila melanogaster diaphanous gene is disrupted in a patient with premature ovarian failure: evidence for conserved function in oogenesis and implications for human sterility. Am J Hum Genet. 1998 Mar;62(3):533-41. [PubMed:9497258 ]
  5. Gasman S, Kalaidzidis Y, Zerial M: RhoD regulates endosome dynamics through Diaphanous-related Formin and Src tyrosine kinase. Nat Cell Biol. 2003 Mar;5(3):195-204. [PubMed:12577064 ]