You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08353
Secondary Accession Numbers
  • 14065
Name Dedicator of cytokinesis protein 2
Synonyms Not Available
Gene Name DOCK2
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function Involved in cytoskeletal rearrangements required for lymphocyte migration in response of chemokines. Activates RAC1 and RAC2 small GTPases, probably by functioning as a guanine nucleotide exchange factor (GEF), which exchanges bound GDP for free GTP. May also participate in IL2 transcriptional activation via the activation of RAC2
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
transition metal ion binding
electron carrier activity
enzyme regulator activity
iron ion binding
protein binding
heme binding
gtpase binding
enzyme binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Cellular Location
  1. Cytoplasm
  2. Endomembrane system
  3. Peripheral membrane protein
  4. cytoskeleton
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35.1
SNPs DOCK2
Gene Sequence
>5493 bp
ATGGCCCCCTGGCGCAAAGCTGACAAGGAGCGGCACGGCGTGGCCATATACAACTTCCAA
GGCAGCGGAGCCCCCCAGCTCTCCCTGCAGATCGGCGATGTGGTGCGAATACAGGAGACG
TGTGGAGACTGGTATAGGGGATACCTCATAAAGCACAAAATGTTACAGGGCATTTTTCCT
AAGTCATTTATCCACATCAAGGAAGTGACAGTTGAGAAAAGAAGAAATACTGAGAACATC
ATTCCTGCAGAAATTCCTCTGGCACAAGAAGTGACAACGACACTTTGGGAATGGGGAAGC
ATCTGGAAACAACTCTATGTGGCCAGCAAAAAGGAGCGTTTTCTCCAGGTGCAGTCCATG
ATGTACGATCTGATGGAGTGGAGGTCCCAGCTTCTCTCAGGAACCTTACCCAAGGATGAG
CTGAAGGAACTGAAGCAGAAAGTCACGTCCAAAATTGACTATGGCAACAAAATCCTTGAG
CTTGATTTGATTGTCAGAGATGAAGACGGAAATATCTTGGACCCTGATAATACCAGTGTC
ATCAGCTTGTTCCATGCACATGAGGAAGCAACTGATAAAATCACAGAGCGTATCAAAGAA
GAAATGTCAAAAGACCAGCCAGATTATGCAATGTATTCCCGGATCTCCTCATCCCCCACC
CATAGCCTCTATGTGTTTGTGAGAAACTTTGTGTGCAGAATTGGGGAAGATGCTGAGCTC
TTCATGTCTCTCTACGACCCCAACAAGCAAACGGTCATAAGTGAGAACTACCTAGTGCGA
TGGGGCAGCCGGGGCTTCCCTAAGGAGATTGAGATGCTCAACAATCTGAAGGTGGTCTTC
ACGGATCTTGGAAACAAAGACCTCAACAGGGATAAAATTTACTTGATTTGTCAAATAGTC
CGGGTCGGCAAGATGGATCTTAAGGATACTGGTGCAAAGAAGTGCACGCAGGGACTGAGG
AGGCCCTTTGGGGTGGCAGTTATGGATATAACAGACATCATCAAGGGGAAAGCAGAGAGT
GATGAAGAAAAGCAGCACTTCATTCCTTTTCACCCGGTTACAGCTGAGAATGACTTCCTA
CACAGCCTGCTGGGCAAAGTCATAGCCTCCAAGGGGGACAGTGGAGGGCAAGGCCTCTGG
GTGACCATGAAGATGCTGGTGGGTGACATCATTCAGATTCGCAAGGACTATCCACACCTG
GTGGACAGGACCACCGTGGTGGCCAGGAAGCTGGGATTCCCAGAGATCATCATGCCAGGG
GATGTCAGGAACGACATCTACATTACTCTCTTACAAGGTGACTTTGACAAGTACAACAAG
ACCACACAGAGGAATGTGGAAGTCATCATGTGTGTGTGCGCGGAGGATGGCAAAACGCTG
CCTAATGCAATTTGCGTGGGAGCAGGGGACAAGCCCATGAATGAGTATCGCTCCGTTGTG
TACTATCAAGTCAAACAGCCACGCTGGATGGAAACAGTCAAGGTGGCTGTCCCTATTGAA
GACATGCAGAGGATCCATCTGCGATTCATGTTTCGACATCGGTCATCTCTGGAATCTAAA
GATAAAGGAGAAAAGAACTTTGCCATGTCCTATGTGAAGCTGATGAAAGAAGATGGGACT
ACTCTACACGATGGATTCCATGACTTAGTTGTCCTCAAGGGGGACAGCAAGAAGATGGAG
GATGCCAGCGCATACCTGACCCTTCCTTCTTATCGACACCATGTGGAAAACAAGGGGGCC
ACGCTGAGCAGGAGCTCCAGCAGTGTTGGGGGGCTTTCTGTCAGCTCCCGGGATGTGTTC
TCCATTTCCACCCTGGTGTGCTCCACAAAGCTCACTCAGAATGTGGGCTTGCTGGGTTTG
CTGAAGTGGCGTATGAAGCCTCAACTGCTACAGGAGAATTTAGAAAAGTTGAAGATTGTG
GATGGAGAGGAAGTGGTGAAGTTTCTCCAGGATACTCTGGATGCCCTCTTCAACATCATG
ATGGAGCATTCTCAAAGTGATGAATATGACATCCTCGTCTTTGATGCCTTGATTTACATA
ATAGGACTCATTGCAGACCGGAAATTTCAGCATTTCAACACCGTTCTGGAGGCTTACATC
CAACAGCATTTCAGTGCGACCTTGGCTTACAAGAAATTGATGACAGTGCTGAAGACTTAC
TTGGATACCTCCAGCAGAGGGGAGCAATGTGAGCCAATCCTAAGAACGCTGAAGGCTTTG
GAATATGTGTTCAAGTTCATTGTTCGGTCGAGGACATTATTTTCACAGCTTTATGAAGGC
AAAGAACAGATGGAGTTTGAAGAATCCATGAGACGGCTCTTTGAATCCATCAACAATCTG
ATGAAAAGTCAATACAAAACTACCATCCTTTTGCAGGTGGCGGCTTTGAAATACATCCCA
TCTGTCCTGCATGATGTAGAAATGGTCTTTGATGCGAAGTTACTCAGCCAACTCCTGTAT
GAGTTCTACACCTGCATCCCTCCTGTGAAACTCCAGAAGCAGAAAGTACAGTCTATGAAT
GAGATAGTCCAGAGCAACCTCTTTAAAAAGCAAGAATGCCGGGACATTCTGCTTCCTGTC
ATCACCAAAGAGCTGAAGGAGCTGCTGGAGCAGAAGGATGACATGCAACACCAGGTCCTG
GAGAGGAAGTACTGCGTTGAATTGCTCAACAGCATCTTGGAAGTCCTTAGCTACCAGGAT
GCGGCCTTCACCTACCACCATATCCAGGAGATCATGGTCCAGCTGCTGCGGACAGTGAAC
CGGACAGTCATCACCATGGGCCGGGATCACATTCTGATTAGTCACTTTGTGGCATGTATG
ACAGCCATCTTAAACCAGATGGGTGACCAGCACTACTCCTTCTACATTGAGACCTTCCAG
ACCAGCTCTGAACTTGTGGACTTCTTGATGGAGACCTTCATCATGTTCAAGGACCTCATT
GGAAAGAACGTGTACCCTGGAGACTGGATGGCCATGAGCATGGTTCAAAACAGGGTCTTC
CTGAGAGCTATCAACAAGTTTGCAGAAACCATGAACCAGAAGTTCCTAGAACACACGAAC
TTTGAGTTCCAGCTGTGGAACAACTATTTTCATCTGGCAGTGGCTTTTATCACCCAGGAT
TCTCTGCAGCTGGAGCAGTTCTCACACGCCAAATACAACAAAATCCTGAATAAGTATGGG
GACATGAGACGGCTAATTGGCTTCTCCATCCGTGATATGTGGTACAAGCTTGGTCAGAAC
AAAATCTGCTTCATCCCAGGCATGGTAGGACCTATATTAGAGATGACACTTATCCCTGAG
GCTGAGCTCCGGAAAGCCACCATACCAATCTTCTTCGACATGATGCTGTGTGAATATCAA
AGAAGTGGGGATTTCAAAAAGTTTGAAAACGAAATCATCCTGAAGCTGGACCACGAGGTA
GAAGGGGGCCGAGGCGACGAGCAGTACATGCAGCTCCTGGAGTCAATCCTGATGGAATGT
GCTGCAGAGCACCCAACCATTGCCAAGTCGGTGGAGAACTTCGTGAACCTGGTCAAAGGC
CTCCTGGAGAAGCTGCTGGATTACCGGGGTGTGATGACAGATGAGAGCAAAGACAACCGC
ATGAGCTGCACCGTGAACCTGCTGAATTTCTACAAAGATAACAACAGGGAGGAGATGTAC
ATAAGGTACCTGTACAAACTCCGCGATCTTCACCTGGACTGTGACAATTACACAGAGGCT
GCCTACACGCTCCTTCTCCACACCTGGCTTCTCAAGTGGTCGGATGAGCAGTGTGCATCA
CAGGTCATGCAGACAGGCCAGCAGCACCCCCAGACACACCGGCAGCTGAAGGAGACGCTC
TACGAGACCATCATAGGCTACTTTGACAAAGGAAAGATGTGGGAAGAGGCCATAAGTCTG
TGCAAGGAGCTGGCGGAACAGTACGAGATGGAGATCTTTGACTATGAGCTGCTCAGCCAG
AACCTGATCCAGCAGGCAAAATTCTATGAAAGCATCATGAAAATCCTCAGGCCCAAACCA
GACTACTTTGCTGTTGGATACTACGGCCAGGGATTCCCCTCCTTCCTGCGGAACAAAGTG
TTCATCTACCGCGGGAAGGAATATGAGCGAAGAGAAGATTTCCAGATGCAGCTGATGACC
CAGTTCCCCAATGCAGAGAAGATGAACACCACCTCTGCCCCGGGAGATGATGTGAAGAAT
GCCCCAGGCCAGTATATCCAGTGCTTCACTGTCCAGCCTGTCTTGGATGAACATCCCAGG
TTCAAGAATAAGCCAGTGCCTGACCAGATTATAAACTTCTACAAATCCAACTACGTGCAA
AGGTTCCACTACTCCCGGCCCGTGCGCAGGGGGACCGTAGACCCAGAGAATGAGTTTGCT
TCCATGTGGATTGAGAGAACCTCCTTCGTGACTGCATACAAGCTGCCGGGGATCCTGCGC
TGGTTTGAGGTGGTGCACATGTCGCAGACCACAATTAGTCCTCTGGAGAATGCCATAGAA
ACCATGTCCACGGCCAATGAGAAGATCCTGATGATGATAAACCAGTACCAGAGTGATGAG
ACCCTCCCCATCAACCCACTCTCCATGCTCCTGAACGGGATTGTGGACCCTGCTGTCATG
GGAGGCTTCGCCAAGTATGAGAAGGCCTTCTTCACTGAAGAGTATGTCAGGGACCACCCT
GAGGACCAGGACAAGCTGACCCACCTCAAGGACCTGATTGCATGGCAGATCCCCTTCTTG
GGAGCTGGGATTAAGATCCATGAGAAAAGGGTGTCAGATAACTTGCGACCCTTCCATGAC
CGGATGGAGGAATGTTTCAAGAACCTGAAAATGAAGGTGGAGAAGGAGTACGGTGTCCGA
GAGATGCCTGACTTTGACGACAGGAGAGTGGGCCGTCCCAGGTCTATGCTGCGCTCATAC
AGACAGATGTCCATCATCTCTCTGGCTTCCATGAATTCTGACTGCAGCACCCCCAGCAAG
CCTACCTCAGAGAGCTTTGACCTGGAATTAGCATCACCCAAGACGCCGAGAGTGGAGCAG
GAGGAACCGATCTCCCCGGGGAGCACCCTGCCTGAGGTCAAGCTGCGGAGGTCCAAGAAG
AGGACAAAGAGAAGCAGCGTAGTTTTTGCGGATGAGAAAGCAGCTGCAGAGTCGGACCTG
AAGCGGCTTTCCAGGAAGCATGAGTTCATGAGTGACACCAACCTCTCGGAGCATGCGGCC
ATCCCCCTCAAGGCGTCTGTCCTCTCTCAAATGAGCTTTGCCAGCCAGTCCATGCCTACC
ATCCCAGCCCTGGCGCTCTCAGTGGCAGGCATCCCTGGGTTGGATGAGGCCAACACATCT
CCCCGCCTCAGCCAGACCTTCCTCCAACTCTCAGATGGTGACAAGAAGACACTCACACGG
AAGAAGGTCAATCAGTTCTTCAAGACAATGCTGGCCAGCAAATCGGCTGAAGAAGGCAAA
CAGATCCCAGACTCGCTGTCCACGGACCTGTGA
Protein Properties
Number of Residues 1830
Molecular Weight 211946.7
Theoretical pI 6.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dedicator of cytokinesis protein 2
MAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFP
KSFIHIKEVTVEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSM
MYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRDEDGNILDPDNTSV
ISLFHAHEEATDKITERIKEEMSKDQPDYAMYSRISSSPTHSLYVFVRNFVCRIGEDAEL
FMSLYDPNKQTVISENYLVRWGSRGFPKEIEMLNNLKVVFTDLGNKDLNRDKIYLICQIV
RVGKMDLKDTGAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVTAENDFL
HSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG
DVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGDKPMNEYRSVV
YYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGT
TLHDGFHDLVVLKGDSKKMEDASAYLTLPSYRHHVENKGATLSRSSSSVGGLSVSSRDVF
SISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVKFLQDTLDALFNIM
MEHSQSDEYDILVFDALIYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYKKLMTVLKTY
LDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESMRRLFESINNL
MKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN
EIVQSNLFKKQECRDILLPVITKELKELLEQKDDMQHQVLERKYCVELLNSILEVLSYQD
AAFTYHHIQEIMVQLLRTVNRTVITMGRDHILISHFVACMTAILNQMGDQHYSFYIETFQ
TSSELVDFLMETFIMFKDLIGKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTN
FEFQLWNNYFHLAVAFITQDSLQLEQFSHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQN
KICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRSGDFKKFENEIILKLDHEV
EGGRGDEQYMQLLESILMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRGVMTDESKDNR
MSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCAS
QVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQ
NLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMT
QFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQ
RFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIE
TMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHP
EDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
EMPDFDDRRVGRPRSMLRSYRQMSIISLASMNSDCSTPSKPTSESFDLELASPKTPRVEQ
EEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAA
IPLKASVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTR
KKVNQFFKTMLASKSAEEGKQIPDSLSTDL
GenBank ID Protein 31377468
UniProtKB/Swiss-Prot ID Q92608
UniProtKB/Swiss-Prot Entry Name DOCK2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004946.2
GeneCard ID DOCK2
GenAtlas ID DOCK2
HGNC ID HGNC:2988
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N: Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. DNA Res. 1996 Oct 31;3(5):321-9, 341-54. [PubMed:9039502 ]
  7. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  8. Nishihara H, Kobayashi S, Hashimoto Y, Ohba F, Mochizuki N, Kurata T, Nagashima K, Matsuda M: Non-adherent cell-specific expression of DOCK2, a member of the human CDM-family proteins. Biochim Biophys Acta. 1999 Nov 11;1452(2):179-87. [PubMed:10559471 ]
  9. Cote JF, Vuori K: Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity. J Cell Sci. 2002 Dec 15;115(Pt 24):4901-13. [PubMed:12432077 ]
  10. Nishihara H, Maeda M, Oda A, Tsuda M, Sawa H, Nagashima K, Tanaka S: DOCK2 associates with CrkL and regulates Rac1 in human leukemia cell lines. Blood. 2002 Dec 1;100(12):3968-74. Epub 2002 Jun 28. [PubMed:12393632 ]
  11. Nishihara H, Maeda M, Tsuda M, Makino Y, Sawa H, Nagashima K, Tanaka S: DOCK2 mediates T cell receptor-induced activation of Rac2 and IL-2 transcription. Biochem Biophys Res Commun. 2002 Aug 23;296(3):716-20. [PubMed:12176041 ]