You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08387
Secondary Accession Numbers
  • 14099
Name Exocyst complex component 8
Synonyms
  1. Exocyst complex 84 kDa subunit
Gene Name EXOC8
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Cell projection
  3. growth cone
Gene Properties
Chromosome Location Chromosome:1
Locus 1q42.2
SNPs EXOC8
Gene Sequence
>2178 bp
ATGGCGATGGCGATGTCGGACAGTGGGGCGAGCCGCCTGCGTCGGCAGCTGGAGTCAGGG
GGTTTTGAGGCGCGGCTGTACGTGAAGCAGCTCTCGCAGCAGTCGGATGGGGACCGGGAC
CTCCAGGAGCACCGGCAGCGCATCCAGGCGCTGGCGGAGGAGACGGCGCAGAACCTGAAG
CGCAACGTCTACCAGAACTACCGGCAGTTCATAGAGACGGCCCGCGAGATCTCCTACCTG
GAGAGCGAGATGTACCAGCTCAGCCATTTGCTGACCGAGCAGAAAAGCAGCCTGGAGAGC
ATCCCGCTTACGTTGCTGCCTGCCGCTGCTGCCGCCGGAGCCGCCGCCGCCTCTGGAGGG
GAGGAGGGAGTCGGTGGGGCGGGGGGCCGAGACCACCTCCGAGGCCAGGCCGGCTTTTTC
TCCACCCCCGGGGGTGCCTCCCGCGACGGCTCCGGTCCAGGCGAGGAAGGAAAGCAGCGC
ACTCTCACCACCCTGCTTGAGAAGGTGGAAGGCTGCAGGCATCTGCTGGAGACGCCGGGA
CAGTACTTGGTGTACAATGGGGACCTAGTGGAATACGATGCGGACCACATGGCCCAACTG
CAGCGGGTGCACGGCTTTCTCATGAACGATTGCTTGTTGGTGGCTACCTGGCTGCCTCAG
CGGCGTGGGATGTATCGCTACAACGCTCTCTATTCCCTAGATGGTTTGGCCGTAGTCAAT
GTCAAGGACAACCCGCCCATGAAGGACATGTTCAAGCTGCTTATGTTCCCCGAGAGCCGT
ATTTTCCAGGCCGAAAATGCTAAAATCAAACGAGAGTGGCTGGAAGTGCTGGAGGACACC
AAGAGGGCCCTCAGTGAGAAAAGGCGAAGGGAGCAGGAGGAGGCAGCGGCCCCTCGAGGG
CCACCCCAAGTGACTTCCAAGGCCACTAACCCATTTGAGGATGACGAAGAAGAAGAACCA
GCTGTTCCTGAGGTAGAGGAAGAGAAGGTGGACCTCTCCATGGAATGGATCCAGGAGTTA
CCTGAAGACCTGGATGTCTGCATTGCGCAGAGAGACTTTGAAGGGGCGGTTGACCTGCTG
GATAAATTGAACCATTACCTGGAAGATAAACCTAGCCCACCTCCTGTAAAAGAACTAAGG
GCCAAAGTGGAGGAGCGAGTTCGACAGCTCACTGAGGTGCTAGTTTTCGAACTCTCCCCA
GATCGTTCCCTGAGAGGTGGTCCGAAGGCTACTCGCAGAGCAGTTTCGCAACTGATCCGG
CTGGGCCAGTGCACGAAGGCCTGTGAGCTATTTTTGAGAAACAGGGCAGCCGCTGTTCAT
ACTGCAATTCGTCAGCTTCGCATCGAAGGTGCCACTTTACTCTATATTCATAAGCTGTGC
CATGTCTTCTTTACCAGCCTTCTCGAGACTGCAAGAGAATTTGAGATCGATTTTGCAGGC
ACTGACAGCGGCTGCTACTCTGCCTTTGTGGTCTGGGCAAGATCAGCCATGGGCATGTTC
GTGGATGCTTTTAGCAAGCAGGTGTTTGATAGTAAGGAGAGCCTCTCTACAGCAGCTGAG
TGTGTAAAAGTGGCTAAGGAGCATTGCCAGCAACTGGGTGATATCGGACTGGATCTCACC
TTCATCATCCATGCCCTTCTGGTGAAAGACATCCAAGGGGCCTTGCACAGTTACAAAGAA
ATCATCATTGAAGCCACTAAACATCGCAACTCTGAAGAGATGTGGAGGAGGATGAACTTG
ATGACGCCAGAAGCCCTGGGTAAGCTCAAAGAAGAGATGAAAAGTTGTGGGGTAAGTAAC
TTTGAGCAGTACACAGGGGATGACTGCTGGGTGAACCTAAGTTACACAGTGGTTGCTTTC
ACCAAACAGACCATGGGCTTCTTGGAAGAGGCCCTGAAGCTGTATTTCCCAGAGCTGCAC
ATGGTACTTTTGGAGAGCCTGGTGGAAATCATTTTGGTTGCTGTTCAGCATGTGGATTAT
AGTCTTCGATGTGAGCAGGATCCAGAGAAGAAAGCTTTTATCAGACAGAATGCATCCTTT
TTATATGAAACAGTCCTCCCTGTGGTGGAGAAAAGGTTTGAAGAAGGTGTGGGGAAACCT
GCCAAGCAACTCCAAGATCTGAGGAATGCATCTAGACTTATTCGTGTGAATCCTGAAAGT
ACAACATCAGTGGTCTAA
Protein Properties
Number of Residues 725
Molecular Weight 81798.4
Theoretical pI 5.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Exocyst complex component 8
MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLK
RNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAGAAAASGG
EEGVGGAGGRDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPG
QYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYSLDGLAVVN
VKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEDTKRALSEKRRREQEEAAAPRG
PPQVTSKATNPFEDDEEEEPAVPEVEEEKVDLSMEWIQELPEDLDVCIAQRDFEGAVDLL
DKLNHYLEDKPSPPPVKELRAKVEERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIR
LGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFEIDFAG
TDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLT
FIIHALLVKDIQGALHSYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSN
FEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDY
SLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPES
TTSVV
GenBank ID Protein 193788401
UniProtKB/Swiss-Prot ID Q8IYI6
UniProtKB/Swiss-Prot Entry Name EXOC8_HUMAN
PDB IDs Not Available
GenBank Gene ID AK096460
GeneCard ID EXOC8
GenAtlas ID EXOC8
HGNC ID HGNC:24659
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  6. Moskalenko S, Tong C, Rosse C, Mirey G, Formstecher E, Daviet L, Camonis J, White MA: Ral GTPases regulate exocyst assembly through dual subunit interactions. J Biol Chem. 2003 Dec 19;278(51):51743-8. Epub 2003 Oct 2. [PubMed:14525976 ]