Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08416
Secondary Accession Numbers
  • 14128
Name Guanylate-binding protein 3
Synonyms
  1. GBP-3
  2. GTP-binding protein 3
  3. Guanine nucleotide-binding protein 3
Gene Name GBP3
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Binds GTP, GDP and GMP
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.2
SNPs GBP3
Gene Sequence
>1788 bp
ATGGCTCCAGAGATCCACATGACAGGCCCAATGTGCCTCATTGAGAACACTAATGGGGAA
CTGGTGGCGAATCCAGAAGCTCTGAAAATCCTGTCTGCCATTACACAGCCTGTGGTGGTG
GTGGCAATTGTGGGCCTCTACCGCACAGGAAAATCCTACCTGATGAACAAGCTAGCTGGG
AAGAATAAGGGCTTCTCTCTGGGCTCCACAGTGAAATCTCACACCAAAGGAATCTGGATG
TGGTGTGTGCCTCACCCCAAAAAGCCAGAACACACCTTAGTCCTGCTTGACACTGAGGGC
CTGGGAGATGTAAAGAAGGGTGACAACCAGAATGACTCCTGGATCTTCACCCTGGCCGTC
CTCCTGAGCAGCACTCTCGTGTACAATAGCATGGGAACCATCAACCAGCAGGCTATGGAC
CAACTGTACTATGTGACAGAGCTGACACATCGAATCCGATCAAAATCCTCACCTGATGAG
AATGAGAATGAGGATTCAGCTGACTTTGTGAGCTTCTTCCCAGATTTTGTGTGGACACTG
AGAGATTTCTCCCTGGACTTGGAAGCAGATGGACAACCCCTCACACCAGATGAGTACCTG
GAGTATTCCCTGAAGCTAACGCAAGGTACCAGTCAAAAAGATAAAAATTTTAATCTGCCC
CGACTCTGTATCCGGAAGTTCTTCCCAAAGAAAAAATGTTTTGTCTTCGATCTGCCCATT
CACCGCAGGAAGCTTGCCCAGCTTGAGAAACTACAAGATGAAGAGCTGGACCCTGAATTT
GTGCAACAAGTAGCAGACTTCTGTTCCTACATCTTTAGCAATTCCAAAACTAAAACTCTT
TCAGGAGGCATCAAGGTCAATGGGCCTCGTCTAGAGAGCCTAGTGCTGACCTATATCAAT
GCTATCAGCAGAGGGGATCTGCCCTGCATGGAGAACGCAGTCCTGGCCTTGGCCCAGATA
GAGAACTCAGCCGCAGTGCAAAAGGCTATTGCCCACTATGACCAGCAGATGGGCCAGAAG
GTGCAGCTGCCCGCAGAAACCCTCCAGGAGCTGCTGGACCTGCACAGGGTTAGTGAGAGG
GAGGCCACTGAAGTCTATATGAAGAACTCTTTCAAGGATGTGGACCATCTGTTTCAAAAG
AAATTAGCGGCCCAGCTAGACAAAAAGCGGGATGACTTTTGTAAACAGAATCAAGAAGCA
TCATCAGATCGTTGCTCAGCTTTACTTCAGGTCATTTTCAGTCCTCTAGAAGAAGAAGTG
AAGGCGGGAATTTATTCGAAACCAGGGGGCTATTGTCTCTTTATTCAGAAGCTACAAGAC
CTGGAGAAAAAGTACTATGAGGAACCAAGGAAGGGGATACAGGCTGAAGAGATTCTGCAG
ACATACTTGAAATCCAAGGAGTCTGTGACCGATGCAATTCTACAGACAGACCAGATTCTC
ACAGAAAAGGAAAAGGAGATTGAAGTGGAATGTGTAAAAGCTGAATCTGCACAGGCTTCA
GCAAAAATGGTGGAGGAAATGCAAATAAAGTATCAGCAGATGATGGAAGAGAAAGAGAAG
AGTTATCAAGAACATGTGAAACAATTGACTGAGAAGATGGAGAGGGAGAGGGCCCAGTTG
CTGGAAGAGCAAGAGAAGACCCTCACTAGTAAACTTCAGGAACAGGCCCGAGTACTAAAG
GAGAGATGCCAAGGTGAAAGTACCCAACTTCAAAATGAGATACAAAAGCTACAGAAGACC
CTGAAAAAAAAAACCAAGAGATATATGTCGCATAAGCTAAAGATCTAA
Protein Properties
Number of Residues 595
Molecular Weight 68113.6
Theoretical pI 6.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 27-47
  • 114-134
Protein Sequence
>Guanylate-binding protein 3
MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFTLAV
LLSSTLVYNSMGTINQQAMDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTL
RDFSLDLEADGQPLTPDEYLEYSLKLTQGTSQKDKNFNLPRLCIRKFFPKKKCFVFDLPI
HRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIKVNGPRLESLVLTYIN
AISRGDLPCMENAVLALAQIENSAAVQKAIAHYDQQMGQKVQLPAETLQELLDLHRVSER
EATEVYMKNSFKDVDHLFQKKLAAQLDKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEV
KAGIYSKPGGYCLFIQKLQDLEKKYYEEPRKGIQAEEILQTYLKSKESVTDAILQTDQIL
TEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQLTEKMERERAQL
LEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI
GenBank ID Protein 112382372
UniProtKB/Swiss-Prot ID Q9H0R5
UniProtKB/Swiss-Prot Entry Name GBP3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018284.2
GeneCard ID GBP3
GenAtlas ID GBP3
HGNC ID HGNC:4184
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]