You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08417
Secondary Accession Numbers
  • 14129
Name Guanylate-binding protein 4
Synonyms
  1. GBP-4
  2. GTP-binding protein 4
  3. Guanine nucleotide-binding protein 4
Gene Name GBP4
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Plays a role in erythroid differentiation
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.2
SNPs GBP4
Gene Sequence
>1923 bp
ATGGGTGAGAGAACTCTTCACGCTGCAGTGCCCACACCAGGTTATCCAGAATCTGAATCC
ATCATGATGGCCCCCATTTGTCTAGTGGAAAACCAGGAAGAGCAGCTGACAGTGAATTCA
AAGGCATTAGAGATTCTTGACAAGATTTCTCAGCCCGTGGTGGTGGTGGCCATTGTAGGG
CTATACCGCACAGGAAAATCCTATCTCATGAATCGTCTTGCAGGAAAGCGCAATGGCTTC
CCTCTGGGCTCCACGGTGCAGTCTGAAACTAAGGGCATCTGGATGTGGTGTGTGCCCCAC
CTCTCTAAGCCAAACCACACCCTGGTCCTTCTGGACACCGAGGGCCTGGGCGATGTAGAA
AAGAGTAACCCTAAGAATGACTCGTGGATCTTTGCCCTGGCTGTGCTTCTAAGCAGCAGC
TTTGTCTATAACAGCGTGAGCACCATCAACCACCAGGCCCTGGAGCAGCTGCACTATGTG
ACTGAGCTAGCAGAGCTAATCAGGGCAAAATCCTGCCCCAGACCTGATGAAGCTGAGGAC
TCCAGCGAGTTTGCGAGTTTCTTTCCAGACTTTATTTGGACTGTTCGGGATTTTACCCTG
GAGCTAAAGTTAGATGGAAACCCCATCACAGAAGATGAGTACCTGGAGAATGCCTTGAAG
CTGATTCCAGGCAAGAATCCCAAAATTCAAAATTCAAACATGCCTAGAGAGTGTATCAGG
CATTTCTTCCGAAAACGGAAGTGCTTTGTCTTTGACCGGCCTACAAATGACAAGCAATAT
TTAAATCATATGGACGAAGTGCCAGAAGAAAATCTGGAAAGGCATTTCCTTATGCAATCA
GACAACTTCTGTTCTTATATCTTCACCCATGCAAAGACCAAGACCCTGAGAGAGGGAATC
ATTGTCACTGGAAAGCGGCTGGGGACTCTGGTGGTGACTTATGTAGATGCCATCAACAGT
GGAGCAGTACCTTGTCTGGAGAATGCAGTGACAGCACTGGCCCAGCTTGAGAACCCAGCG
GCTGTGCAGAGGGCAGCCGACCACTATAGCCAGCAGATGGCCCAGCAACTGAGGCTCCCC
ACAGACACGCTCCAGGAGCTGCTGGACGTGCATGCAGCCTGTGAGAGGGAAGCCATTGCA
GTCTTCATGGAGCACTCCTTCAAGGATGAAAACCATGAATTCCAGAAGAAGCTTGTGGAC
ACCATAGAGAAAAAGAAGGGAGACTTTGTGCTGCAGAATGAAGAGGCATCTGCCAAATAT
TGCCAGGCTGAGCTTAAGCGGCTTTCAGAGCACCTGACAGAAAGCATTTTGAGAGGAATT
TTCTCTGTTCCTGGAGGACACAATCTCTACTTAGAAGAAAAGAAACAGGTTGAGTGGGAC
TATAAGCTAGTGCCCAGAAAAGGAGTTAAGGCAAACGAGGTCCTCCAGAACTTCCTGCAG
TCACAGGTGGTTGTAGAGGAATCCATCCTGCAGTCAGACAAAGCCCTCACTGCTGGAGAG
AAGGCCATAGCAGCGGAGCGGGCCATGAAGGAAGCAGCTGAGAAGGAACAGGAGCTGCTA
AGAGAAAAACAGAAGGAGCAGCAGCAAATGATGGAGGCTCAAGAGAGAAGCTTCCAGGAA
AACATAGCTCAACTCAAGAAGAAGATGGAGAGGGAAAGGGAAAACCTTCTCAGAGAGCAT
GAAAGGCTGCTAAAACACAAGCTGAAGGTACAAGAAGAAATGCTTAAGGAAGAATTTCAA
AAGAAATCTGAGCAGTTAAATAAAGAGATTAATCAACTGAAAGAAAAAATTGAAAGCACT
AAAAATGAACAGTTAAGGCTCTTAAAGATCCTTGACATGGCTAGCAACATAATGATTGTC
ACTCTACCTGGGGCTTCCAAGCTACTTGGAGTAGGGACAAAATATCTTGGCTCACGTATT
TAA
Protein Properties
Number of Residues 640
Molecular Weight 73164.2
Theoretical pI 5.89
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanylate-binding protein 4
MGERTLHAAVPTPGYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVG
LYRTGKSYLMNRLAGKRNGFPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVE
KSNPKNDSWIFALAVLLSSSFVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAED
SSEFASFFPDFIWTVRDFTLELKLDGNPITEDEYLENALKLIPGKNPKIQNSNMPRECIR
HFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQSDNFCSYIFTHAKTKTLREGI
IVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQMAQQLRLP
TDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASAKY
CQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVEWDYKLVPRKGVKANEVLQNFLQ
SQVVVEESILQSDKALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQE
YMAQMEKKLEEERENLLREHERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQLKEKIEST
KNEQLRLLKILDMASNIMIVTLPGASKLLGVGTKYLGSRI
GenBank ID Protein 15558943
UniProtKB/Swiss-Prot ID Q96PP9
UniProtKB/Swiss-Prot Entry Name GBP4_HUMAN
PDB IDs Not Available
GenBank Gene ID AF288814
GeneCard ID GBP4
GenAtlas ID GBP4
HGNC ID HGNC:20480
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Kim SC, Sprung R, Chen Y, Xu Y, Ball H, Pei J, Cheng T, Kho Y, Xiao H, Xiao L, Grishin NV, White M, Yang XJ, Zhao Y: Substrate and functional diversity of lysine acetylation revealed by a proteomics survey. Mol Cell. 2006 Aug;23(4):607-18. [PubMed:16916647 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O: Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. DNA Res. 2003 Feb 28;10(1):49-57. [PubMed:12693554 ]