You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08420
Secondary Accession Numbers
  • 14132
Name ADP-ribosylation factor-binding protein GGA1
Synonyms
  1. Gamma-adaptin-related protein 1
  2. Golgi-localized, gamma ear-containing, ARF-binding protein 1
Gene Name GGA1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF- dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane coat
golgi apparatus part
cell part
intracellular part
macromolecular complex
protein complex
cytoplasmic part
ap-type membrane coat adaptor complex
intracellular
clathrin adaptor complex
Function
binding
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Endosome membrane
  4. Golgi apparatus
  5. trans-Golgi network membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.31
SNPs GGA1
Gene Sequence
>1920 bp
ATGGAGCCCGCGATGGAGCCGGAGACTCTGGAGGCGCGAATCAATAGAGCCACGAACCCC
CTGAACAAGGAGCTCGACTGGGCCAGCATCAACGGCTTCTGCGAGCAGCTCAACGAGGAC
TTTGAGGGGCCTCCACTCGCCACCCGGCTGCTGGCCCACAAGATCCAGTCCCCACAGGAG
TGGGAGGCGATCCAGGCCTTGACGGTGCTGGAAACATGCATGAAGAGCTGCGGCAAGCGG
TTCCACGACGAAGTGGGCAAGTTCCGCTTTCTCAACGAGCTCATCAAGGTCGTGTCTCCC
AAGTATCTGGGCTCTCGGACATCGGAGAAGGTGAAGAACAAGATCTTGGAGCTCCTCTAC
AGCTGGACAGTGGGCCTGCCCGAGGAGGTGAAAATCGCAGAGGCCTACCAGATGCTAAAG
AAGCAGGGGATTGTAAAGTCCGACCCCAAGCTTCCAGATGACACTACCTTTCCCCTTCCT
CCTCCACGGCCGAAGAATGTGATCTTTGAAGATGAGGAGAAATCCAAGATGCTGGCCCGC
CTGCTGAAGAGCTCCCATCCCGAAGACCTCCGCGCAGCCAATAAGCTCATCAAAGAGATG
GTGCAGGAGGACCAGAAGCGGATGGAGAAGATCTCGAAGAGGGTGAATGCCATCGAGGAG
GTGAACAACAATGTGAAACTGCTCACGGAGATGGTGATGAGCCACAGCCAGGGCGGCGCA
GCAGCTGGCAGCAGCGAGGACCTCATGAAGGAACTGTACCAGCGCTGTGAGCGGATGCGG
CCCACGCTCTTCCGACTGGCGAGTGACACAGAGGACAATGATGAGGCCTTAGCGGAGATC
CTGCAGGCCAATGACAACCTCACCCAGGTGATCAACCTGTATAAGCAGCTGGTGCGGGGT
GAGGAGGTCAACGGTGATGCCACAGCCGGCTCCATCCCTGGGAGCACCTCGGCCCTGCTG
GATCTCTCAGGCCTGGATCTCCCGCCTGCGGGCACCACCTACCCAGCTATGCCCACCCGC
CCTGGCGAGCAGGCCAGCCCTGAGCAACCCAGTGCCTCAGTTTCCCTGCTTGACGACGAG
CTCATGTCTCTGGGCCTCAGTGACCCCACACCCCCTTCAGGCCCAAGCCTGGATGGTACC
GGATGGAACAGCTTCCAGTCGTCGGATGCCACTGAGCCCCCAGCCCCTGCTCTGGCCCAG
GCCCCCAGTATGGAAAGCCGACCCCCAGCGCAGACATCCCTGCCAGCAAGCAGCGGTCTG
GACGACCTAGACCTCCTGGGGAAGACCCTCCTGCAGCAGTCGCTGCCCCCGGAATCCCAG
CAAGTGCGGTGGGAGAAGCAGCAGCCAACCCCCCGGCTCACACTCCGGGACCTGCAGAAT
AAGAGCAGCAGCTGCAGCTCCCCCAGCTCCAGCGCCACCAGCCTTCTCCACACCGTGTCC
CCAGAGCCCCCCAGGCCTCCGCAGCAGCCCGTACCAACCGAGCTCTCACTGGCCAGCATC
ACTGTGCCCCTGGAGTCCATCAAACCCAGCAACATCCTGCCCGTGACTGTGTATGACCAG
CACGGCTTCCGCATCCTCTTCCATTTTGCCCGGGACCCACTGCCAGGGCGCTCCGACGTG
CTGGTGGTGGTGGTTTCCATGCTGAGCACCGCCCCCCAGCCCATCCGCAACATCGTGTTC
CAGTCAGCTGTCCCCAAGGTTATGAAGGTGAAGCTGCAGCCACCCTCGGGCACGGAGCTG
CCAGCTTTTAACCCCATCGTCCACCCCTCAGCAATCACCCAGGTCCTGCTGCTTGCCAAC
CCCCAGAAGGAGAAGGTTCGCCTCCGCTACAAGCTCACCTTCACCATGGGTGACCAGACC
TACAACGAGATGGGGGATGTGGACCAGTTCCCCCCACCTGAAACCTGGGGTAGCCTCTAG
Protein Properties
Number of Residues 639
Molecular Weight 70383.5
Theoretical pI 4.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>ADP-ribosylation factor-binding protein GGA1
MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
SWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLAR
LLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGA
AAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRG
EEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDE
LMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGL
DDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVS
PEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDV
LVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLAN
PQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
GenBank ID Protein 6179912
UniProtKB/Swiss-Prot ID Q9UJY5
UniProtKB/Swiss-Prot Entry Name GGA1_HUMAN
PDB IDs
GenBank Gene ID AF190862
GeneCard ID GGA1
GenAtlas ID GGA1
HGNC ID HGNC:17842
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  8. Puertollano R, Aguilar RC, Gorshkova I, Crouch RJ, Bonifacino JS: Sorting of mannose 6-phosphate receptors mediated by the GGAs. Science. 2001 Jun 1;292(5522):1712-6. [PubMed:11387475 ]
  9. He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J: Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins. Biochemistry. 2003 Oct 28;42(42):12174-80. [PubMed:14567678 ]
  10. Boman AL, Zhang Cj, Zhu X, Kahn RA: A family of ADP-ribosylation factor effectors that can alter membrane transport through the trans-Golgi. Mol Biol Cell. 2000 Apr;11(4):1241-55. [PubMed:10749927 ]
  11. Dell'Angelica EC, Puertollano R, Mullins C, Aguilar RC, Vargas JD, Hartnell LM, Bonifacino JS: GGAs: a family of ADP ribosylation factor-binding proteins related to adaptors and associated with the Golgi complex. J Cell Biol. 2000 Apr 3;149(1):81-94. [PubMed:10747089 ]
  12. Hirst J, Lui WW, Bright NA, Totty N, Seaman MN, Robinson MS: A family of proteins with gamma-adaptin and VHS domains that facilitate trafficking between the trans-Golgi network and the vacuole/lysosome. J Cell Biol. 2000 Apr 3;149(1):67-80. [PubMed:10747088 ]
  13. Takatsu H, Yoshino K, Nakayama K: Adaptor gamma ear homology domain conserved in gamma-adaptin and GGA proteins that interact with gamma-synergin. Biochem Biophys Res Commun. 2000 May 19;271(3):719-25. [PubMed:10814529 ]
  14. Puertollano R, Randazzo PA, Presley JF, Hartnell LM, Bonifacino JS: The GGAs promote ARF-dependent recruitment of clathrin to the TGN. Cell. 2001 Apr 6;105(1):93-102. [PubMed:11301005 ]
  15. Takatsu H, Katoh Y, Shiba Y, Nakayama K: Golgi-localizing, gamma-adaptin ear homology domain, ADP-ribosylation factor-binding (GGA) proteins interact with acidic dileucine sequences within the cytoplasmic domains of sorting receptors through their Vps27p/Hrs/STAM (VHS) domains. J Biol Chem. 2001 Jul 27;276(30):28541-5. Epub 2001 Jun 4. [PubMed:11390366 ]
  16. Takatsu H, Yoshino K, Toda K, Nakayama K: GGA proteins associate with Golgi membranes through interaction between their GGAH domains and ADP-ribosylation factors. Biochem J. 2002 Jul 15;365(Pt 2):369-78. [PubMed:11950392 ]
  17. Jacobsen L, Madsen P, Nielsen MS, Geraerts WP, Gliemann J, Smit AB, Petersen CM: The sorLA cytoplasmic domain interacts with GGA1 and -2 and defines minimum requirements for GGA binding. FEBS Lett. 2002 Jan 30;511(1-3):155-8. [PubMed:11821067 ]
  18. Doray B, Bruns K, Ghosh P, Kornfeld SA: Autoinhibition of the ligand-binding site of GGA1/3 VHS domains by an internal acidic cluster-dileucine motif. Proc Natl Acad Sci U S A. 2002 Jun 11;99(12):8072-7. [PubMed:12060753 ]
  19. Mattera R, Arighi CN, Lodge R, Zerial M, Bonifacino JS: Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. 2003 Jan 2;22(1):78-88. [PubMed:12505986 ]
  20. Ghosh P, Kornfeld S: Phosphorylation-induced conformational changes regulate GGAs 1 and 3 function at the trans-Golgi network. J Biol Chem. 2003 Apr 18;278(16):14543-9. Epub 2003 Feb 10. [PubMed:12578827 ]
  21. Mills IG, Praefcke GJ, Vallis Y, Peter BJ, Olesen LE, Gallop JL, Butler PJ, Evans PR, McMahon HT: EpsinR: an AP1/clathrin interacting protein involved in vesicle trafficking. J Cell Biol. 2003 Jan 20;160(2):213-22. Epub 2003 Jan 21. [PubMed:12538641 ]
  22. Ghosh P, Griffith J, Geuze HJ, Kornfeld S: Mammalian GGAs act together to sort mannose 6-phosphate receptors. J Cell Biol. 2003 Nov 24;163(4):755-66. [PubMed:14638859 ]
  23. Lui WW, Collins BM, Hirst J, Motley A, Millar C, Schu P, Owen DJ, Robinson MS: Binding partners for the COOH-terminal appendage domains of the GGAs and gamma-adaptin. Mol Biol Cell. 2003 Jun;14(6):2385-98. Epub 2003 Mar 20. [PubMed:12808037 ]
  24. Shiba Y, Katoh Y, Shiba T, Yoshino K, Takatsu H, Kobayashi H, Shin HW, Wakatsuki S, Nakayama K: GAT (GGA and Tom1) domain responsible for ubiquitin binding and ubiquitination. J Biol Chem. 2004 Feb 20;279(8):7105-11. Epub 2003 Dec 2. [PubMed:14660606 ]
  25. Mattera R, Ritter B, Sidhu SS, McPherson PS, Bonifacino JS: Definition of the consensus motif recognized by gamma-adaptin ear domains. J Biol Chem. 2004 Feb 27;279(9):8018-28. Epub 2003 Dec 9. [PubMed:14665628 ]
  26. Mattera R, Puertollano R, Smith WJ, Bonifacino JS: The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. J Biol Chem. 2004 Jul 23;279(30):31409-18. Epub 2004 May 13. [PubMed:15143060 ]
  27. Puertollano R, Bonifacino JS: Interactions of GGA3 with the ubiquitin sorting machinery. Nat Cell Biol. 2004 Mar;6(3):244-51. Epub 2004 Feb 22. [PubMed:15039775 ]
  28. Shiba T, Takatsu H, Nogi T, Matsugaki N, Kawasaki M, Igarashi N, Suzuki M, Kato R, Earnest T, Nakayama K, Wakatsuki S: Structural basis for recognition of acidic-cluster dileucine sequence by GGA1. Nature. 2002 Feb 21;415(6874):937-41. [PubMed:11859376 ]
  29. Shiba T, Kawasaki M, Takatsu H, Nogi T, Matsugaki N, Igarashi N, Suzuki M, Kato R, Nakayama K, Wakatsuki S: Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport. Nat Struct Biol. 2003 May;10(5):386-93. [PubMed:12679809 ]
  30. Collins BM, Praefcke GJ, Robinson MS, Owen DJ: Structural basis for binding of accessory proteins by the appendage domain of GGAs. Nat Struct Biol. 2003 Aug;10(8):607-13. [PubMed:12858163 ]