You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08422
Secondary Accession Numbers
  • 14134
Name ADP-ribosylation factor-binding protein GGA3
Synonyms
  1. Golgi-localized, gamma ear-containing, ARF-binding protein 3
Gene Name GGA3
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF- dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane coat
golgi apparatus part
cell part
intracellular part
macromolecular complex
protein complex
cytoplasmic part
ap-type membrane coat adaptor complex
intracellular
clathrin adaptor complex
Function
binding
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Endosome membrane
  4. Golgi apparatus
  5. trans-Golgi network membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.1
SNPs GGA3
Gene Sequence
>2172 bp
ATGGCGGAGGCGGAAGGGGAAAGCCTGGAGTCCTGGCTCAATAAAGCCACCAATCCTTCC
AACCGCCAGGAGGACTGGGAATACATAATTGGCTTCTGTGATCAGATCAACAAGGAGCTG
GAAGGGCCACAGATCGCCGTCCGACTGCTGGCCCACAAGATCCAGTCCCCACAGGAATGG
GAGGCGCTCCAGGCCCTGACGGTGCTGGAGGCATGCATGAAGAACTGTGGGAGGAGATTT
CATAACGAAGTGGGGAAGTTCCGCTTTTTGAATGAGTTAATCAAAGTCGTCTCTCCAAAG
TACCTGGGGGACAGGGTGTCTGAGAAAGTGAAGACCAAGGTTATTGAGCTGCTGTACAGC
TGGACCATGGCCCTGCCAGAAGAAGCAAAGATCAAAGACGCCTACCACATGCTGAAGAGA
CAGGGCATAGTGCAGTCTGACCCACCAATTCCTGTGGATAGGACGCTGATCCCCTCTCCA
CCACCTCGTCCCAAAAACCCTGTTTTTGATGATGAGGAGAAGTCCAAGCTTTTAGCCAAG
CTGCTGAAAAGCAAAAACCCAGATGACCTGCAGGAGGCCAACAAGCTCATCAAGTCCATG
GTGAAGGAAGACGAGGCACGGATCCAGAAGGTGACCAAGCGTCTGCACACGTTAGAGGAA
GTTAACAACAACGTGAGACTGCTCAGTGAGATGCTGCTTCATTACAGCCAGGAGGACTCT
TCGGACGGGGACAGAGAGCTGATGAAGGAGCTGTTTGATCAGTGTGAGAACAAGAGGCGG
ACTTTATTTAAACTCGCCAGTGAGACTGAGGACAATGATAACAGTTTGGGGGACATCCTG
CAAGCCAGTGACAACCTCTCCCGGGTCATCAACTCTTACAAAACAATTATTGAAGGGCAG
GTCATCAATGGCGAGGTGGCTACCTTAACCCTGCCTGACTCGGAAGGAAACAGTCAGTGC
AGTAACCAAGGCACGCTCATCGACCTTGCGGAGCTGGACACGACCAACAGTTTGTCCTCC
GTGTTGGCCCCAGCACCTACTCCACCCTCCTCAGGCATCCCAATCCTCCCTCCACCACCC
CAGGCCTCAGGACCTCCACGGAGCCGCTCCTCTAGCCAGGCCGAGGCCACCCTGGGGCCC
AGCAGCACAAGCAACGCCCTCTCCTGGCTGGACGAGGAGCTACTCTGCTTGGGCCTCGCC
GACCCAGCCCCTAATGTTCCTCCCAAAGAGTCAGCTGGGAACAGCCAGTGGCACCTGCTC
CAGAGGGAACAGTCCGACCTGGACTTCTTCAGCCCCAGGCCGGGGACCGCTGCCTGTGGC
GCCTCCGATGCTCCTCTGCTCCAGCCCTCAGCCCCCTCCTCAAGCAGCTCCCAAGCTCCA
CTGCCGCCTCCCTTCCCAGCTCCTGTGGTCCCAGCCAGTGTTCCTGCCCCCAGTGCGGGC
TCCTCCTTGTTTTCTACTGGAGTGGCCCCAGCCTTGGCCCCAAAAGTTGAGCCCGCAGTC
CCTGGGCACCATGGCTTGGCGTTGGGCAACAGCGCGCTGCACCACCTGGATGCCCTCGAT
CAGCTTCTAGAAGAGGCCAAAGTGACCTCGGGCTTGGTGAAACCCACTACCTCCCCTCTC
ATCCCCACCACCACCCCAGCCAGGCCCCTCCTGCCCTTCTCCACGGGGCCCGGCAGCCCG
CTCTTCCAGCCACTGAGTTTCCAGTCCCAGGGCAGCCCCCCGAAGGGGCCTGAGCTCTCC
CTGGCCAGCATCCACGTGCCCCTGGAATCGATCAAGCCTAGCAGTGCCCTTCCTGTGACA
GCCTACGATAAAAACGGCTTCCGCATCCTCTTCCACTTTGCCAAGGAGTGTCCCCCAGGA
CGACCTGACGTGCTGGTGGTGGTGGTGTCCATGCTGAACACGGCTCCCTTACCTGTCAAG
AGCATCGTGCTGCAGGCTGCAGTGCCCAAGTCAATGAAAGTGAAGTTGCAGCCACCTTCT
GGGACAGAACTCTCTCCATTTAGCCCCATCCAGCCACCTGCAGCCATCACCCAGGTCATG
TTGCTGGCCAATCCACTGAAGGAGAAGGTGCGGCTTCGGTATAAGCTGACCTTCGCCCTG
GGGGAGCAGCTGAGCACAGAGGTGGGCGAGGTGGACCAGTTCCCTCCTGTGGAACAGTGG
GGGAACCTATGA
Protein Properties
Number of Residues 723
Molecular Weight 78314.5
Theoretical pI 5.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>ADP-ribosylation factor-binding protein GGA3
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYS
WTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDS
SDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
VINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPP
QASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLL
QREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAG
SSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPL
IPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVT
AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS
GTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQW
GNL
GenBank ID Protein 20336267
UniProtKB/Swiss-Prot ID Q9NZ52
UniProtKB/Swiss-Prot Entry Name GGA3_HUMAN
PDB IDs
GenBank Gene ID NM_138619.2
GeneCard ID GGA3
GenAtlas ID GGA3
HGNC ID HGNC:17079
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Nagase T, Seki N, Tanaka A, Ishikawa K, Nomura N: Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1995 Aug 31;2(4):167-74, 199-210. [PubMed:8590280 ]
  4. Puertollano R, Aguilar RC, Gorshkova I, Crouch RJ, Bonifacino JS: Sorting of mannose 6-phosphate receptors mediated by the GGAs. Science. 2001 Jun 1;292(5522):1712-6. [PubMed:11387475 ]
  5. He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J: Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins. Biochemistry. 2003 Oct 28;42(42):12174-80. [PubMed:14567678 ]
  6. Boman AL, Zhang Cj, Zhu X, Kahn RA: A family of ADP-ribosylation factor effectors that can alter membrane transport through the trans-Golgi. Mol Biol Cell. 2000 Apr;11(4):1241-55. [PubMed:10749927 ]
  7. Dell'Angelica EC, Puertollano R, Mullins C, Aguilar RC, Vargas JD, Hartnell LM, Bonifacino JS: GGAs: a family of ADP ribosylation factor-binding proteins related to adaptors and associated with the Golgi complex. J Cell Biol. 2000 Apr 3;149(1):81-94. [PubMed:10747089 ]
  8. Takatsu H, Yoshino K, Nakayama K: Adaptor gamma ear homology domain conserved in gamma-adaptin and GGA proteins that interact with gamma-synergin. Biochem Biophys Res Commun. 2000 May 19;271(3):719-25. [PubMed:10814529 ]
  9. Puertollano R, Randazzo PA, Presley JF, Hartnell LM, Bonifacino JS: The GGAs promote ARF-dependent recruitment of clathrin to the TGN. Cell. 2001 Apr 6;105(1):93-102. [PubMed:11301005 ]
  10. Takatsu H, Yoshino K, Toda K, Nakayama K: GGA proteins associate with Golgi membranes through interaction between their GGAH domains and ADP-ribosylation factors. Biochem J. 2002 Jul 15;365(Pt 2):369-78. [PubMed:11950392 ]
  11. Doray B, Bruns K, Ghosh P, Kornfeld SA: Autoinhibition of the ligand-binding site of GGA1/3 VHS domains by an internal acidic cluster-dileucine motif. Proc Natl Acad Sci U S A. 2002 Jun 11;99(12):8072-7. [PubMed:12060753 ]
  12. Mattera R, Arighi CN, Lodge R, Zerial M, Bonifacino JS: Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. 2003 Jan 2;22(1):78-88. [PubMed:12505986 ]
  13. Ghosh P, Griffith J, Geuze HJ, Kornfeld S: Mammalian GGAs act together to sort mannose 6-phosphate receptors. J Cell Biol. 2003 Nov 24;163(4):755-66. [PubMed:14638859 ]
  14. Shiba Y, Katoh Y, Shiba T, Yoshino K, Takatsu H, Kobayashi H, Shin HW, Wakatsuki S, Nakayama K: GAT (GGA and Tom1) domain responsible for ubiquitin binding and ubiquitination. J Biol Chem. 2004 Feb 20;279(8):7105-11. Epub 2003 Dec 2. [PubMed:14660606 ]
  15. Mattera R, Ritter B, Sidhu SS, McPherson PS, Bonifacino JS: Definition of the consensus motif recognized by gamma-adaptin ear domains. J Biol Chem. 2004 Feb 27;279(9):8018-28. Epub 2003 Dec 9. [PubMed:14665628 ]
  16. Mattera R, Puertollano R, Smith WJ, Bonifacino JS: The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. J Biol Chem. 2004 Jul 23;279(30):31409-18. Epub 2004 May 13. [PubMed:15143060 ]
  17. Puertollano R, Bonifacino JS: Interactions of GGA3 with the ubiquitin sorting machinery. Nat Cell Biol. 2004 Mar;6(3):244-51. Epub 2004 Feb 22. [PubMed:15039775 ]
  18. Wasiak S, Legendre-Guillemin V, Puertollano R, Blondeau F, Girard M, de Heuvel E, Boismenu D, Bell AW, Bonifacino JS, McPherson PS: Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics. J Cell Biol. 2002 Sep 2;158(5):855-62. Epub 2002 Sep 3. [PubMed:12213833 ]
  19. Kato Y, Misra S, Puertollano R, Hurley JH, Bonifacino JS: Phosphoregulation of sorting signal-VHS domain interactions by a direct electrostatic mechanism. Nat Struct Biol. 2002 Jul;9(7):532-6. [PubMed:12032548 ]