You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08434
Secondary Accession Numbers
  • 14146
Name Golgin-45
Synonyms
  1. Basic leucine zipper nuclear factor 1
  2. JEM-1
  3. p45 basic leucine-zipper nuclear factor
Gene Name BLZF1
Protein Type Unknown
Biological Properties
General Function Involved in transcription factor activity
Specific Function Required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Isoform 2:Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1q24
SNPs BLZF1
Gene Sequence
>1203 bp
ATGACTACTAAAAATTTAGAAACCAAAGTCACCGTTACTTCATCCCCAATCCGAGGAGCA
GGAGATGGAATGGAAACTGAGGAACCACCTAAATCTGTTGAAGTTACCTCCGGAGTCCAA
TCTAGAAAGCATCATAGTCTTCAGAGTCCATGGAAGAAAGCAGTTCCATCAGAGAGCCCA
GGAGTTCTTCAGCTAGGGAAAATGCTCACTGAAAAAGCAATGGAAGTTAAAGCTGTAAGA
ATATTAGTTCCCAAAGCTGCTATAACTCATGATATCCCCAACAAAAATACAAAGGTTAAG
TCTCTGGGACATCATAAAGGAGAATTCCTTGGTCAGTCAGAGGGAGTTATAGAACCTAAT
AAGGAACTCTCAGAGGTAAAGAATGTATTGGAAAAGCTCAAGAATTCTGAAAGAAGGTTA
CTACAGGACAAAGAAGGTCTTTCAAACCAGCTCCGTGTACAGACAGAGGTAAATCGTGAG
TTAAAAAAGTTACTGGTGGCTTCTGTTGGGGATGATCTTCAGTATCACTTTGAACGTCTA
GCCCGTGAGAAAAATCAGCTTATTTTAGAAAATGAAGCCCTAGGTCGAAACACAGCTCAG
CTTTCTGAACAGTTAGAACGTATGTCAATACAGTGTGATGTATGGCGAAGTAAATTCCTT
GCAAGCAGGGTAATGGCAGATGAGTTAACCAACTCAAGAGCAGCTTTACAGCGTCAAAAC
CGTGATGCACACGGGGCTATACAAGATCTCCTAAGTGAACGGGAACAGTTTCGTCAAGAA
ATGATAGCTACCCAGAAATTATTGGAGGAGCTCTTAGTTTCCTTGCAATGGGGAAGAGAG
CAAACTTACTCCCCTAGTGTACAACCCCACAGCACAGCAGAGCTAGCATTAACAAATCAC
AAGTTGGCAAAAGCAGTAAATTCTCATCTTCTGGGAAATGTTGGCATTAACAATCAAAAA
AAGATTCCATCAACAGTTGAATTCTGCAGCACCCCAGCTGAGAAAATGGCTGAAACGGTT
CTAAGAATTTTAGATCCAGTTACCTGCAAAGAGAGTTCACCTGATAATCCATTTTTTGAG
TCTTCACCAACCACCTTACTTGTTACAAAGAAAAATATTGGACGATTTCATCCCTATACT
AGATATGAAAATATAACTTTCAATTGCTGCAATCACTGCCGGGGAGAACTGATTGCCCTT
TAA
Protein Properties
Number of Residues 400
Molecular Weight 44909.9
Theoretical pI 8.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Golgin-45
MTTKNLETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVQSRKHHSLQSPWKKAVPSESP
GVLQLGKMLTEKAMEVKAVRILVPKAAITHDIPNKNTKVKSLGHHKGEFLGQSEGVIEPN
KELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERL
AREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMADELTNSRAALQRQN
RDAHGAIQDLLSEREQFRQEMIATQKLLEELLVSLQWGREQTYSPSVQPHSTAELALTNH
KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFE
SSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL
GenBank ID Protein 11545323
UniProtKB/Swiss-Prot ID Q9H2G9
UniProtKB/Swiss-Prot Entry Name GO45_HUMAN
PDB IDs Not Available
GenBank Gene ID AF272386
GeneCard ID BLZF1
GenAtlas ID BLZF1
HGNC ID HGNC:1065
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Duprez E, Tong JH, Derre J, Chen SJ, Berger R, Chen Z, Lanotte M: JEM-1, a novel gene encoding a leucine-zipper nuclear factor upregulated during retinoid-induced maturation of NB4 promyelocytic leukaemia. Oncogene. 1997 Apr 3;14(13):1563-70. [PubMed:9129147 ]
  6. Tong JH, Fant X, Benoit G, Chen SJ, Chen Z, Lanotte M: Genomic organization of the JEM-1 (BLZF1) gene on human chromosome 1q24: molecular cloning and analysis of its promoter region. Genomics. 2000 Nov 1;69(3):380-90. [PubMed:11056056 ]
  7. Short B, Preisinger C, Korner R, Kopajtich R, Byron O, Barr FA: A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. J Cell Biol. 2001 Dec 10;155(6):877-83. Epub 2001 Dec 10. [PubMed:11739401 ]