You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08437
Secondary Accession Numbers
  • 14149
Name RAS guanyl-releasing protein 4
Synonyms Not Available
Gene Name RASGRP4
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Functions as a cation- and diacylglycerol (DAG)- regulated nucleotide exchange factor activating Ras through the exchange of bound GDP for GTP. May function in mast cells differentiation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
intracellular signal transduction
small gtpase mediated signal transduction
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.1
SNPs RASGRP4
Gene Sequence
>2022 bp
ATGAACAGAAAAGACAGTAAGAGGAAGTCCCACCAGGAATGCACCGGAAAAATAGGAGGG
CGAGGCCGGCCCCGCCAAGTGCGCCGCCACAAGACATGCCCCAGCCCTCGGGAAATCAGC
AAGGTCATGGCTTCCATGAACCTGGGCCTGCTGAGTGAGGGCGGCTGCAGCGAAGATGAG
CTGCTGGAGAAATGCATCCAGTCCTTCGATTCAGCTGGCAGCCTGTGCCACGAGGACCAC
ATGCTCAACATGGTGCTGGCCATGCACAGCTGGGTGCTGCCGTCCGCCGACCTGGCTGCC
CGCCTGCTGACCTCATACCAGAAGGCCACAGGGGACACCCAGGAGCTGAGACGGCTGCAG
ATCTGTCACCTGGTCAGGTACTGGCTGATGCGACACCCTGAGGTGATGCACCAGGATCCC
CAGCTAGAAGAAGTCATAGGTCGTTTCTGGGCCACCGTGGCCCGGGAGGGCAACTCAGCC
CAGAGAAGACTGGGAGACTCTTCTGACCTCCTGAGCCCTGGTGGCCCTGGCCCCCCACTC
CCAATGAGCAGCCCAGGCCTGGGCAAAAAGCGCAAAGTGTCCTTGCTTTTCGACCACTTG
GAGACGGGGGAGCTGGCTCAGCACCTCACCTACCTGGAGTTCCGGTCCTTCCAGGCTATC
ACGCCCCAGGACCTGCGGAGCTACGTTTTGCAGGGCTCAGTACGAGGCTGCCCGGCCCTG
GAGGGCTCCGTAGGTCTCAGCAACAGCGTGTCCCGCTGGGTGCAGGTGATGGTGCTGAGC
CGTCCCGGGCCCCTACAGCGTGCACAGGTGCTGGACAAGTTCATTCACGTGGCACAGAGG
CTCCACCAGCTGCAGAATTTCAACACGCTGATGGCAGTCACAGGGGGCCTGTGTCACAGT
GCCATCTCCAGACTCAAGGACTCCCATGCCCACCTGAGCCCTGACAGCACCAAGGCCCTC
CTGGAGCTCACTGAGCTCCTTGCCTCCCACAACAACTACGCCCGCTACCGCCGCACCTGG
GCTGGCTGCGCGGGTTTCCGGCTGCCTGTACTGGGCGTGCACCTCAAGGACCTGGTGTCC
CTGCATGAGGCACAGCCCGACAGGTTGCCTGACGGCCGCCTGCACCTACCCAAGCTGAAC
AACCTCTACCTGCGGCTGCAGGAGCTGGTGGCCCTCCAAGGGCAGCATCCACCCTGCAGC
GCCAATGAGGATCTGCTGCACCTGCTCACGCTCTCCCTGGACCTCTTCTACACGGAAGAC
GAGATCTATGAGCTTTCTTATGCCCGGGAGCCGCGTTGTCCCAAGAGCCTGCCACCCTCC
CCCTTCAATGCACCTCTGGTGGTGGAGTGGGCCCCTGGTGTGACACCCAAGCCGGACAGG
GTCACACTGGGTCGGCATGTGGAGCAGCTGGTGGAGTCTGTGTTCAAGAATTATGACCCT
GAAGGCCGAGGAACAATCTCTCAGGAGGACTTTGAGCGACTCTCGGGCAATTTTCCCTTC
GCCTGCCATGGGCTTCACCCACCCCCACGCCAGGGGAGAGGATCCTTCAGCAGAGAGGAG
CTGACAGGGTACCTGCTCCGGGCCAGCGCCATCTGCTCCAAGTTGGGCCTGGCCTTCCTG
CACACCTTCCATGAGGTCACCTTCCGAAAGCCTACCTTCTGCGACAGCTGCAGTGGCTTC
CTCTGGGGTGTCACCAAGCAAGGCTACCGCTGTCGGGAGTGCGGGCTGTGTTGCCACAAA
CACTGCAGAGACCAGGTGAAGGTAGAATGTAAGAAGAGGCCAGGGGCCAAGGGCGATGCA
GGACCCCCCGGAGCTCCTGTCCCATCCACACCAGCTCCCCATGCCAGCTGTGGCTCCGAG
GAAAATCACTCCTACACGCTATCCCTGGAGCCTGAGACTGGGTGCCAGCTTCGCCATGCC
TGGACCCAGACTGAATCCCCACACCCTTCCTGGGAAACAGATACGGTCCCCTGCCCGGTG
ATGGACCCACCATCAACTGCATCCTCCAAGCTGGATTCCTAG
Protein Properties
Number of Residues 673
Molecular Weight 74881.7
Theoretical pI 8.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>RAS guanyl-releasing protein 4
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVS
LHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDP
EGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFL
HTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDA
GPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPV
MDPPSTASSKLDS
GenBank ID Protein 26051258
UniProtKB/Swiss-Prot ID Q8TDF6
UniProtKB/Swiss-Prot Entry Name GRP4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_170604.2
GeneCard ID RASGRP4
GenAtlas ID RASGRP4
HGNC ID HGNC:18958
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Yang Y, Li L, Wong GW, Krilis SA, Madhusudhan MS, Sali A, Stevens RL: RasGRP4, a new mast cell-restricted Ras guanine nucleotide-releasing protein with calcium- and diacylglycerol-binding motifs. Identification of defective variants of this signaling protein in asthma, mastocytosis, and mast cell leukemia patients and demonstration of the importance of RasGRP4 in mast cell development and function. J Biol Chem. 2002 Jul 12;277(28):25756-74. Epub 2002 Apr 15. [PubMed:11956218 ]
  4. Reuther GW, Lambert QT, Rebhun JF, Caligiuri MA, Quilliam LA, Der CJ: RasGRP4 is a novel Ras activator isolated from acute myeloid leukemia. J Biol Chem. 2002 Aug 23;277(34):30508-14. Epub 2002 Mar 5. [PubMed:11880369 ]
  5. Li L, Yang Y, Stevens RL: RasGRP4 regulates the expression of prostaglandin D2 in human and rat mast cell lines. J Biol Chem. 2003 Feb 14;278(7):4725-9. Epub 2002 Dec 18. [PubMed:12493770 ]
  6. Katsoulotos GP, Qi M, Qi JC, Tanaka K, Hughes WE, Molloy TJ, Adachi R, Stevens RL, Krilis SA: The Diacylglycerol-dependent translocation of ras guanine nucleotide-releasing protein 4 inside a human mast cell line results in substantial phenotypic changes, including expression of interleukin 13 receptor alpha2. J Biol Chem. 2008 Jan 18;283(3):1610-21. Epub 2007 Nov 16. [PubMed:18024961 ]