You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08447
Secondary Accession Numbers
  • 14159
Name Probable E3 ubiquitin-protein ligase HERC1
Synonyms
  1. HECT domain and RCC1-like domain-containing protein 1
  2. p532
  3. p619
Gene Name HERC1
Protein Type Unknown
Biological Properties
General Function Involved in acid-amino acid ligase activity
Specific Function Involved in membrane trafficking via some guanine nucleotide exchange factor (GEF) activity and its ability to bind clathrin. Acts as a GEF for Arf and Rab, by exchanging bound GDP for free GTP. Binds phosphatidylinositol-4,5-bisphosphate, which is required for GEF activity. May also act as a E3 ubiquitin- protein ligase which accepts ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Membrane
  4. Golgi apparatus
  5. cytosol
Gene Properties
Chromosome Location Chromosome:1
Locus 15q22
SNPs HERC1
Gene Sequence
>14586 bp
ATGGCAACTATGATTCCACCAGTGAAGCTGAAATGGCTTGAACACTTGAACAGCTCCTGG
ATTACAGAGGACAGTGAATCTATTGCTACAAGAGAGGGAGTTGCTGTTCTGTATTCTAAA
CTGGTTAGCAATAAGGAAGTAGTACCTTTGCCCCAACAAGTTTTATGCCTCAAAGGACCA
CAGTTGCCAGACTTTGAACGTGAGTCTCTTTCAAGTGATGAGCAGGACCACTATTTGGAT
GCCCTTCTTAGCAGCCAGCTAGCATTGGCAAAGATGGTATGTTCAGATTCCCCATTTGCC
GGGGCACTTAGAAAACGACTGCTTGTACTCCAGCGTGTCTTTTATGCACTTTCTAATAAA
TACCATGACAAAGGCAAGGTGAAGCAGCAGCAGCATTCTCCGGAGAGCAGTTCTGGTTCA
GCAGATGTCCATTCTGTTAGTGAACGCCCCCGGTCAAGCACTGATGCACTTATAGAAATG
GGTGTTCGAACTGGTCTAAGTTTATTATTTGCGCTTCTAAGACAAAGTTGGATGATGCCT
GTGTCAGGACCTGGTCTCAGTCTTTGCAACGATGTCATTCATACTGCAATTGAAGTTGTG
AGCTCTTTGCCACCATTATCATTAGCAAATGAAAGCAAGATTCCTCCTATGGGCTTGGAC
TGCTTATCGCAAGTAACAACATTTCTTAAAGGAGTCACTATTCCTAATTCTGGGGCAGAC
ACTTTAGGTCGTAGATTAGCTTCTGAGTTGCTGCTTGGTTTGGCAGCTCAACGAGGCTCA
TTGCGATATCTTCTTGAATGGATAGAAATGGCTTTGGGGGCTTCGGCAGTTGTACACACC
ATGGAGAAAGGCAAACTACTCTCAAGCCAGGAAGGAATGATCAGCTTTGACTGCTTTATG
ACCATATTAATGCAGATGAGGCGTTCTTTGGGTTCATCTGCTGATCGGAGTCAGTGGAGA
GAACCAACCAGAACATCGGATGGCTTGTGCTCCCTTTACGAGGCAGCATTATGTCTCTTT
GAAGAGGTTTGCAGAATGGCTTCTGATTATTCGAGAACATGTGCTAGCCCAGATAGCATT
CAGACTGGTGATGCTCCCATTGTCTCCGAAACCTGTGAGGTTTATGTTTGGGGGAGCAAT
AGCAGCCATCAGTTGGTAGAAGGTACACAGGAGAAAATACTGCAACCCAAACTGGCTCCT
AGTTTCTCTGATGCACAGACCATTGAAGCTGGACAGTACTGCACTTTTGTCATTTCTACG
GATGGCTCTGTTAGAGCTTGCGGGAAAGGCAGCTATGGGAGACTGGGCCTTGGAGACTCC
AATAATCAGTCAACTTTAAAAAAGTTAACATTCGAGCCTCACAGATCCATTAAAAAGGTT
TCATCTTCTAAAGGATCTGATGGTCACACTTTAGCCTTTACGACAGAAGGAGAAGTCTTC
AGTTGGGGAGATGGTGATTATGGGAAACTGGGGCATGGAAATAGTTCAACACAGAAATAT
CCCAAGCTTATTCAGGGACCTCTACAAGGAAAGGTAGTTGTTTGTGTGTCAGCTGGATAC
AGACATAGTGCTGCTGTCACAGAGGATGGGGAATTATACACATGGGGTGAAGGAGACTTT
GGAAGATTAGGTCATGGTGACAGCAATAGTCGTAACATTCCAACATTAGTAAAAGACATC
AGCAATGTAGGAGAGGTTTCTTGTGGCAGTTCACATACTATTGCTCTGTCTAAAGATGGG
AGAACTGTATGGTCTTTTGGAGGAGGAGACAATGGTAAACTTGGTCATGGTGATACCAAC
AGAGTGTATAAACCTAAAGTTATTGAAGCTTTACAAGGAATGTTCATTCGCAAAGTTTGT
GCTGGGAGCCAGTCTTCACTTGCTTTGACATCAACAGGGCAGGTCTATGCTTGGGGCTGT
GGAGCTTGTCTAGGTTGTGGTTCTTCAGAAGCTACTGCTTTGAGACCCAAGCTTATTGAA
GAACTGGCTGCCACAAGAATAGTTGATGTTTCTATTGGAGACAGTCATTGTTTGGCTCTT
TCTCATGATAATGAAGTTTATGCCTGGGGCAATAACTCAATGGGGCAATGTGGTCAGGGA
AATTCCACAGGTCCTATTACTAAACCAAAGAAAGTGAGTGGCTTAGATGGCATAGCTATT
CAGCAGATTTCGGCTGGAACATCACATAGTCTGGCATGGACTGCTCTTCCTAGGGACAGA
CAAGTTGTTGCATGGCACCGACCTTATTGTGTAGATCTTGAAGAGAGTACCTTCTCACAC
CTGCGTTCTTTTCTTGAGAGATACTGTGATAAAATAAACAGTGAGATTCCCCCACTCCCT
TTCCCTTCATCAAGAGAACACCACAGTTTTCTCAAGCTGTGCCTGAAGCTACTTTCAAAT
CACCTTGCTCTTGCACTTGCGGGAGGGGTAGCTACCAGCATTCTCGGGAGGCAGGCAGGT
CCACTTCGAAATTTGCTCTTCAGACTGATGGACTCAACTGTCCCAGATGAAATCCAAGAG
GTGGTAATTGAAACTTTATCAGTGGGAGCAACCATGCTGTTACCTCCATTACGAGAACGG
ATGGAATTACTTCATTCTCTTTTACCTCAAGGACCTGATAGATGGGAAAGCTTATCTAAA
GGACAGAGAATGCAACTGGATATCATCCTGACAAGTTTGCAAGATCATACCCACGTAGCC
TCCCTACTTGGCTATAGTTCACCCTCTGATGCTGCTGACCTATCTTCTGTGTGTACTGGC
TACGGAAATCTGTCAGATCAACCTTACGGCACTCAGAGCTGCCATCCAGATACCCACCTG
GCTGAAATTTTGATGAAGACCCTCTTAAGAAATTTAGGATTTTATACAGATCAAGCATTT
GGAGAGCTAGAAAAGAATAGTGATAAATTTCTACTTGGAACATCATCATCAGAAAACAGT
CAGCCTGCTCATCTTCATGAACTGCTATGTTCACTACAGAAACAGCTGCTGGCATTTTGC
CATATCAATAACATTAGTGAGAACTCAAGCAGTGTGGCATTGCTTCATAAACATCTTCAG
CTTTTGTTGCCTCATGCCACAGATATTTATTCACGTTCTGCAAATTTGCTCAAAGAAAGT
CCTTGGAATGGCAGTGTTGGAGAAAAATTAAGAGATGTGATATACGTCTCAGCTGCTGGC
AGTATGCTCTGCCAGATTGTTAACTCCCTGCTGTTACTCCCTGTGTCAGTGGCTCGGCCT
TTATTGAGTTACCTCCTCGACTTGTTGCCACCTCTTGATTGCCTTAATAGACTCCTGCCA
GCTGCTGATCTTTTAGAAGACCAGGAGTTACAGTGGCCTCTTCATGGAGGGCCAGAACTA
ATTGATCCTGCTGGTCTGCCATTACCTCAGCCAGCTCAGTCCTGGGTATGGCTTGTGGAT
CTAGAAAGAACAATTGCTCTCCTTATTGGGCGGTGTCTTGGTGGCATGCTTCAGGGCTCC
CCTGTGTCTCCAGAGGAACAGGACACTGCATATTGGATGAAAACGCCACTGTTCAGTGAC
GGTGTAGAAATGGACACTCCTCAATTGGATAAATGTATGAGTTGCCTGTTAGAAGTAGCA
CTTTCTGGAAATGAAGAACAGAAGCCTTTTGATTATAAATTGCGGCCTGAAATTGCTGTC
TATGTAGACTTGGCATTGGGTTGTTCTAAAGAGCCTGCCCGAAGCCTTTGGATCAGCATG
CAGGACTATGCTGTTAGTAAAGATTGGGACAGTGCAACTTTAAGTAATGAGTCACTCTTG
GACACTGTGTCTAGATTTGTTCTTGCAGCTCTTCTGAAACACACAAATTTACTTAGTCAA
GCATGTGGAGAAAGCCGATATCAACCTGGTAAACACTTATCAGAAGTGTACCGTTGTGTA
TACAAAGTTCGAAGTCGTTTACTTGCTTGCAAGAACCTTGAACTTATTCAAACAAGGTCA
TCATCACGGGACAGATGGATATCAGAAAACCAGGACTCTGCAGATGTTGATCCTCAGGAG
CATTCATTTACTCGAACTATTGATGAAGAAGCTGAAATGGAAGAACAGGCTGAGAGAGAC
CGGGAAGAGGGGCATCCGGAGCCAGAGGATGAAGAGGAGGAACGGGAACATGAAGTGATG
ACAGCTGGCAAAATCTTTCAGTGTTTCCTCTCAGCCCGTGAAGTAGCTCGTAGCCGAGAC
CGAGATAGAATGAACAGTGGGGCAGGGTCTGGGGCTCGAGCTGATGATCCACCTCCTCAG
TCTCAGCAAGAGCGAAGGGTCAGCACAGACCTTCCTGAGGGTCAGGATGTGTACACTGCT
GCATGCAACTCCGTGATCCATCGGTGTGCCCTGTTAATATTAGGAGTAAGTCCTGTGATA
GATGAGCTTCAGAAGCGAAGAGAAGAAGGACAGTTGCAGCAACCTTCAACAAGTGCCTCT
GAAGGGGGTGGACTTATGACCAGGAGTGAAAGTCTTACTGCAGAGAGCCGGCTAGTCCAC
ACAAGCCCAAATTATAGACTGATCAAATCGAGGAGTGAATCTGATTTGTCTCAGCCTGAA
TCAGATGAAGAGGGTTACGCACTGAGTGGCAGACGAAATGTTGATTTGGATTTGGCAGCA
TCTCACAGAAAGAGAGGTCCTATGCACAGTCAATTGGAATCCCTGAGTGACTCTTGGGCT
CGCCTGAAACATAGCAGAGACTGGTTATGCAACTCCTCCTATTCCTTTGAGTCAGATTTT
GATCTTACCAAGTCTTTGGGAGTTCACACTTTGATTGAAAATGTTGTAAGCTTTGTGAGT
GGAGATGTGGGGAATGCCCCAGGTTTTAAAGAGCCAGAGGAAAGTATGTCTACAAGTCCC
CAGGCCTCCATCATTGCAATGGAACAGCAGCAGTTAAGGGCAGAACTTCGTTTAGAGGCA
CTTCATCAGATCCTCGTTCTATTGTCTGGGATGGAAGAAAAAGGTAGCATCTCACTGGCA
GGAAGCAGATTGAGTTCAGGCTTCCAGTCCTCCACACTACTCACGTCTGTGAGGCTGCAG
TTCCTAGCAGGGTGTTTTGGTTTAGGCACTGTTGGACACACAGGAGGCAAGGGAGAGAGT
GGCCGATTGCATCACTATCAGGATGGGATCAGAGCAGCTAAGAGAAATATTCAGATTGAA
ATCCAGGTAGCTGTGCATAAAATTTATCAACAGTTGTCTGCTACCCTGGAAAGAGCCCTG
CAAGCAAACAAGCATCACATTGAAGCCCAGCAACGTCTGCTTCTGGTTACAGTTTTTGCC
CTAAGTGTTCATTATCAACCAGTAGATGTTTCTTTGGCAATTTCCACTGGTCTGCTAAAC
GTATTGTCACAGTTGTGTGGTACAGACACCATGCTAGGACAGCCCCTGCAGTTGTTGCCA
AAGACGGGTGTTTCCCAGCTTAGCACAGCTTTGAAAGTGGCCAGTACAAGGTTGCTCCAG
ATTCTAGCCATCACTACTGGGACCTATGCTGATAAACTGAGTCCCAAAGTAGTTCAATCC
TTGTTGGATCTACTCTGTAGTCAGTTGAAGAATTTATTGTCCCAAACTGGTGTACTACAT
ATGGCCTCTTTCGGAGAAGGGGAGCAAGAAGACGGTGAAGAAGAAGAAAAAAAAGTTGAC
TCCAGTGGAGAAACTGAGAAGAAAGATTTCAGAGCTGCTCTTAGGAAACAACATGCAGCC
GAACTCCATCTAGGGGATTTTTTAGTTTTTCTTCGCAGAGTTGTATCTTCAAAAGCAATT
CAATCAAAAATGGCTTCCCCAAAGTGGACCGAAGTGCTTCTAAATATAGCATCTCAGAAA
TGTTCTTCAGGTATCCCTCTGGTTGGTAACTTAAGAACAAGGCTCCTTGCACTTCATGTC
CTTGAAGCTGTGCTGCCAGCTTGTGAATCTGGTGTAGAAGATGATCAAATGGCCCAGATT
GTTGAGCGCTTATTTTCCCTTCTCTCTGATTGTATGTGGGAGACACCCATTGCTCAGGCC
AAACATGCTATTCAGATAAAGGAAAAAGAACAAGAAATAAAACTACAGAAGCAGGGCGAG
TTGGAAGAAGAAGATGAGAATCTTCCTATCCAAGAAGTATCCTTTGACCCGGAGAAAGCT
CAGTGTTGCCTAGTGGAGAATGGACAGATTTTAACTCACGGCAGTGGAGGGAAAGGATAT
GGATTGGCATCTACAGGAGTAACTTCTGGGTGCTATCAGTGGAAGTTTTATATTGTGAAG
GAAAACAGAGGTAATGAAGGCACGTGTGTTGGAGTTTCTCGCTGGCCAGTACATGACTTT
AATCACCGCACTACCTCGGATATGTGGCTCTATAGGGCCTACAGTGGTAACCTCTATCAC
AATGGAGAACAGACTCTCACATTGTCCAGCTTTACTCAAGGAGATTTCATTACCTGTGTG
TTAGACATGGAAGCCAGGACCATTTCTTTTGGGAAAAATGGAGAGGAACCCAAATTAGCT
TTTGAAGATGTGGATGCAGCAGAGTTGTACCCATGTGTGATGTTCTATAGTAGCAATCCA
GGGGAAAAGGTGAAAATTTGTGATATGCAGATGCGTGGCACACCCCGAGACTTACTTCCA
GGAGACCCTATTTGTAGTCCAGTAGCAGCAGTGCTGGCTGAGGCCACTATTCAGCTCATC
CGTATCCTTCACCGAACAGACCGTTGGACTTACTGCATTAACAAAAAAATGATGGAAAGG
CTTCACAAAATTAAGATATGTATTAAAGAGTCAGGTCAGAAGCTAAAGAAAAGCCGCTCG
GTTCAGAGCCGAGAGGAAAATGAAATGAGAGAGGAGAAGGAGAGCAAAGAGGAAGAGAAA
GGTAAACATACTAGGCATGGCCTCGCTGACCTCTCAGAGCTGCAGCTGAGGACTCTTTGC
ATAGAGGTGTGGCCCGTGCTGGCTGTGATAGGAGGAGTTGATGCTGGTCTTAGAGTTGGA
GGTCGGTGTGTTCACAAGCAAACTGGGCGCCATGCCACGCTGCTGGGAGTGGTCAAAGAG
GGCAGCACGTCTGCCAAGGTCCAATGGGATGAAGCAGAAATTACTATCAGCTTCCCAACT
TTTTGGTCGCCTAGTGATACTCCATTGTATAATCTGGAACCCTGTGAACCATTGCCGTTT
GATGTGGCGCGATTCCGAGGCCTGACGGCTTCTGTGCTGCTGGACCTAACATATCTCACT
GGCGTTCATGAAGACATGGGCAAACAGAGCACCAAACGACATGAAAAGAAACACCGACAT
GAATCCGAGGAGAAAGGGGATGTTGAGCAGAAACCTGAGAGTGAATCCGCTTTAGATATG
CGAACAGGCCTAACATCTGATGACGTCAAAAGTCAGAGTACCACAAGCTCCAAATCAGAA
AATGAAATCGCTTCATTTTCTTTAGATCCAACACTGCCAAGTGTGGAATCCCAACATCAA
ATAACAGAAGGGAAAAGAAAAAATCATGAACACATGTCCAAAAACCATGATGTAGCCCAG
TCAGAAATCAGAGCAGTCCAGCTGTCCTATCTTTACCTCGGTGCTATGAAGTCACTTAGT
GCCCTTCTTGGCTGTAGTAAATATGCTGAGCTGTTGCTGATACCAAAAGTTCTGGCTGAA
AATGGCCACAACTCAGACTGTGCAAGTTCTCCAGTTGTTCATGAAGACGTGGAGATGCGA
GCAGCCCTGCAGTTCTTGATGCGACACATGGTGAAGCGAGCAGTCATGCGGTCACCCATA
AAGAGAGCATTGGGATTAGCTGATCTGGAACGAGCGCAAGCCATGATCTATAAATTAGTG
GTTCATGGGCTTTTGGAAGACCAGTTTGGGGGCAAAATTAAGCAAGAGATTGATCAACAA
GCTGAAGAAAGTGACCCTGCCCAGCAGGCACAGACACCAGTTACTACTAGCCCATCAGCC
TCAAGCACGACCTCCTTTATGAGCAGCTCTCTGGAGGACACCACAACTGCCACCACTCCA
GTCACTGACACAGAAACAGTGCCTGCATCCGAGTCCCCGGGAGTGATGCCTCTTAGTCTT
CTCAGGCAAATGTTCTCTAGTTACCCAACTACCACTGTACTTCCCACACGTCGGGCACAG
ACTCCTCCAATATCTTCGTTACCAACCTCTCCTTCTGATGAAGTAGGAAGGAGGCAAAGT
TTAACTTCTCCTGATTCCCAGTCAGCAAGGCCAGCTAACCGCACAGCCTTGTCAGACCCA
AGCAGTAGACTTTCAACTTCTCCTCCTCCTCCAGCAATTGCAGTTCCCTTGCTGGAAATG
GGGTTCTCTCTTCGGCAGATTGCCAAAGCCATGGAAGCTACAGGTGCTAGGGGAGAGGCT
GATGCCCAGAATATCACTGTCCTTGCCATGTGGATGATAGAGCACCCTGGGCATGAGGAT
GAAGAGGAGCCCCAGTCGGGCAGCACAGCAGACTCTAGGCCTGGAGCAGCCGTTCTAGGC
AGTGGCGGGAAGTCAAATGATCCCTGTTATTTGCAGTCACCTGGAGACATACCATCAGCT
GATGCTGCTGAAATGGAGGAAGGTTTTAGTGAAAGCCCTGATAATTTGGATCATACAGAG
AATGCAGCTTCTGGAAGTGGACCATCAGCTAGAGGTCGCTCAGCGGTAACAAGAAGACAC
AAGTTTGACTTAGCTGCTCGCACACTGCTAGCAAGAGCAGCGGGATTATACCGCTCTGTG
CAGGCCCACAGGAATCAAAGTCGGAGAGAAGGAATATCTTTGCAGCAAGACCCAGGGGCG
TTGTATGACTTTAATTTAGATGAGGAATTGGAAATTGATCTTGATGATGAGGCGATGGAA
GCTATGTTTGGACAAGACCTGACCAGTGACAATGATATTCTGGGAATGTGGATCCCAGAG
GTACTGGATTGGCCTACCTGGCATGTTTGTGAGTCTGAAGACAGGGAAGAAGTGGTGGTG
TGTGAACTGTGTGAATGCAGCGTCGTCAGCTTCAATCAGCACATGAAGAGAAACCATCCA
GGCTGTGGGCGCAGTGCAAACCGCCAGGGCTATCGCAGCAATGGTTCCTATGTGGATGGC
TGGTTTGGCGGTGAATGTGGGAGTGGAAATCCGTACTACCTGTTATGTGGCACCTGCAGG
GAGAAGTACTTAGCCATGAAGACCAAATCTAAGTCAACAAGTTCTGAAAGGTACAAGGGA
CAAGCTCCAGATCTAATTGGCAAGCAAGACAGTGTGTATGAAGAAGACTGGGACATGTTG
GATGTTGATGAAGATGAAAAGCTAACTGGTGAAGAAGAATTTGAATTACTTGCTGGACCG
CTTGGTTTAAATGACCGGCGCATTGTACCAGAACCAGTTCAGTTCCCTGACAGCGATCCA
CTGGGAGCATCAGTAGCAATGGTCACAGCCACCAACAGTATGGAAGAGACTCTGATGCAA
ATAGGTTGCCATGGCTCCGTAGAAAAGAGCTCCTCTGGGAGAATAACGTTAGGAGAGCAG
GCAGCTGCCCTAGCAAACCCTCATGACCGTGTGGTGGCTTTAAGGAGAGTGACTGCTGCT
GCTCAGGTTCTTCTGGCCAGAACCATGGTCATGAGAGCGCTGTCTCTTCTCTCAGTCAGT
GGTTCCAGTTGTAGCCTGGCTGCTGGTCTTGAGTCTCTGGGGCTAACAGATATCCGAACG
CTAGTTCGATTAATGTGCTTGGCAGCAGCAGGGAGAGCTGGCCTCTCCACCAGCCCTTCT
GCCATGGCTAGCACCTCAGAACGATCACGAGGTGGGCATAGCAAGGCTAACAAGCCTATC
TCTTGCCTGGCCTATTTGAGCACAGCAGTGGGATGTCTGGCATCAAATGCTCCTAGTGCT
GCCAAACTGCTTGTACAGTTGTGTACACAGAACTTGATTTCTGCTGCAACAGGTGTAAAT
CTAACCACAGTTGATGACTCAATTCAGCGAAAGTTTCTACCCAGCTTTCTCCGAGGAATT
GCTGAAGAGAACAAGCTTGTGACCTCCCCAAACTTTGTTGTAACACAGGCCCTTGTGGCA
TTGCTAGCAGACAAAGGGGCCAAACTAAGACCTAACTATGATAAGTCAGAAGTTGAAAAG
AAAGGCCCTCTGGAGTTGGCTAATGCCCTGGCAGCCTGCTGCCTCTCCTCCAGGCTGTCC
TCACAGCATCGGCAATGGGCAGCTCAGCAACTCGTGCGCACTCTTGCTGCACACGACCGT
GACAACCAAACTACTCTGCAGACACTTGCTGATATGGGAGGAGATCTTAGAAAATGCTCC
TTTATCAAATTGGAGGCTCATCAGAACAGAGTAATGACATGTGTTTGGTGTAATAAAAAA
GGTCTTTTGGCTACAAGTGGCAATGATGGCACCATCCGCGTATGGAATGTTACCAAGAAG
CAATATTCACTGCAACAGACCTGTGTGTTCAACAGATTGGAAGGGGATGCTGAGGAAAGC
CTGGGATCACCCAGTGATCCAAGTTTCTCACCAGTTTCCTGGAGTATCAGTGGCAAATAT
CTAGCAGGCGCTTTGGAAAAGATGGTGAATATCTGGCAAGTTAATGGAGGAAAAGGATTA
GTAGATATTCAGCCTCATTGGGTATCTGCCCTGGCTTGGCCAGAAGAGGGTCCGGCTACA
GCCTGGTCAGGAGAGTCTCCAGAATTGTTGTTGGTGGGACGGATGGATGGATCTCTGGGA
CTGATTGAAGTTGTTGATGTGTCCACCATGCACCGTCGAGAATTGGAGCATTGCTATCGA
AAGGATGTGTCTGTTACTTGCATTGCATGGTTCAGTGAAGACAGACCATTTGCAGTGGGA
TATTTTGATGGAAAACTGTTACTGGGAACAAAGGAACCACTTGAGAAAGGAGGCATTGTT
CTAATTGATGCACATAAGGATACTCTTATTAGCATGAAGTGGGACCCTACAGGTCATATT
CTTATGACATGTGCCAAAGAAGACAGTGTGAAACTCTGGGGCTCTATTTCGGGATGCTGG
TGCTGTCTACATTCACTCTGCCATCCATCTATTGTAAATGGCATTGCTTGGTGCCGCCTT
CCAGGGAAAGGATCCAAGTTGCAGTTACTGATGGCTACTGGCTGTCAGAGTGGCTTAGTA
TGTGTTTGGCGCATTCCTCAAGATACTACACAGACCAATGTGACTAGTGCAGAAGGATGG
TGGGAGCAGGAATCAAATTGCCAGGATGGATATAGGAAATCATCAGGAGCCAAGTGTGTT
TATCAGCTGCGGGGACACATCACTCCTGTTCGGACTGTTGCCTTTAGTTCTGATGGGTTG
GCCCTGGTGTCTGGTGGACTAGGTGGGCTCATGAACATTTGGTCTTTAAGGGATGGCTCT
GTCTTGCAAACTGTTGTGATAGGCTCTGGAGCTATTCAGACCACAGTATGGATTCCAGAA
GTTGGAGTAGCTGCTTGCTCAAATAGATCAAAGGATGTTTTGGTCGTGAATTGTACAGCA
GAATGGGCAGCTGCCAATCATGTTTTGGCAACCTGTAGGACAGCATTGAAACAGCAGGGT
GTTCTGGGATTGAACATGGCTCCCTGCATGAGAGCATTTTTGGAGCGGCTCCCCATGATG
CTTCAGGAGCAGTATGCCTATGAAAAGCCTCATGTGGTTTGTGGTGACCAACTTGTTCAT
AGCCCCTATATGCAATGCTTGGCTTCCCTTGCTGTGGGACTTCATCTGGATCAGCTGTTG
TGTAACCCTCCAGTGCCACCACACCACCAGAACTGTCTCCCTGACCCTGCATCCTGGAAT
CCAAATGAATGGGCCTGGTTAGAATGTTTCTCAACCACTATAAAAGCTGCCGAAGCCCTG
ACCAATGGAGCCCAGTTTCCAGAATCTTTTACCGTTCCAGATCTAGAACCTGTTCCAGAG
GATGAACTTGTATTTCTAATGGATAACAGTAAATGGATTAACGGCATGGATGAACAAATT
ATGTCTTGGGCAACTTCCAGACCTGAGGACTGGCACCTGGGAGGTAAATGTGATGTCTAC
TTATGGGGTGCTGGTAGGCATGGACAGCTGGCAGAAGCTGGAAGAAATGTAATGGTACCT
GCAGCAGCTCCCTCATTCTCACAGGCCCAACAGGTCATTTGTGGTCAGAATTGTACCTTT
GTCATCCAGGCCAATGGCACAGTGTTGGCTTGTGGGGAAGGAAGTTATGGCAGATTAGGA
CAAGGAAATTCAGATGACCTTCATGTGCTGACAGTTATTTCAGCCTTACAAGGCTTTGTG
GTGACCCAGCTGGTGACTTCCTGTGGTTCTGATGGGCACTCTATGGCCCTAACTGAAAGT
GGTGAGGTCTTTAGCTGGGGAGATGGTGACTATGGTAAACTTGGCCATGGGAACAGCGAC
AGGCAGCGGCGGCCCAGGCAGATCGAGGCCTTACAAGGAGAAGAAGTGGTGCAGATGTCT
TGTGGCTTCAAGCACTCAGCAGTGGTCACTTCAGATGGCAAACTGTTCACCTTTGGGAAT
GGTGACTATGGTCGTCTGGGTCTTGGAAATACCTCTAACAAAAAACTTCCAGAGAGAGTG
ACTGCACTGGAGGGATATCAGATTGGACAGGTGGCCTGTGGATTAAACCACACTTTGGCA
GTGTCAGCAGATGGTTCCATGGTGTGGGCTTTTGGAGATGGAGACTATGGAAAACTAGGC
TTAGGAAATTCCACTGCAAAATCTTCACCTCAGAAAATTGACGTCCTTTGTGGAATTGGA
ATAAAAAAGGTTGCTTGTGGAACTCAGTTTTCTGTTGCTTTGACCAAAGATGGTCATGTG
TATACCTTTGGTCAAGATCGCCTGATAGGCTTGCCAGAGGGGCGTGCTCGCAATCACAAT
CGACCGCAACAAATCCCTGTCCTGGCTGGAGTAATCATAGAAGATGTGGCAGTTGGAGCT
GAACACACACTTGCTTTGGCATCAAATGGAGATGTGTATGCCTGGGGGAGCAATTCAGAA
GGGCAGCTCGGCTTAGGCCATACCAACCATGTTCGAGAACCAACCCTGGTAACAGGTCTG
CAAGGGAAAAATGTTCGGCAGATCTCGGCTGGCCGCTGCCACAGTGCTGCATGGACAGCA
CCACCTGTCCCACCAAGAGCACCAGGTGTGTCAGTACCTCTGCAGCTGGGCCTGCCTGAC
ACAGTGCCCCCCCAGTATGGGGCGCTGAGAGAAGTCAGCATTCACACGGTGCGGGCCAGG
CTCCGGCTGCTCTACCACTTCTCTGACCTCATGTACTCATCCTGGAGACTGCTGAACCTT
AGCCCCAACAACCAGAACAGCACATCCCATTATAATGCTGGAACTTGGGGCATTGTACAG
GGACAACTTCGGCCTTTGTTAGCCCCAAGAGTCTACACTCTGCCAATGGTGCGCTCCATA
GGAAAAACCATGGTTCAAGGCAAAAACTATGGACCTCAGATAACTGTAAAGAGGATATCA
ACCAGAGGACGGAAGTGTAAGCCTATTTTTGTCCAAATAGCGAGACAAGTAGTTAAGCTG
AATGCTTCAGACCTCCGCCTGCCTTCCCGAGCGTGGAAGGTTAAGCTGGTTGGAGAAGGG
GCTGATGATGCTGGAGGAGTGTTTGATGACACCATCACAGAGATGTGCCAGGAACTTGAA
ACTGGTATTGTTGACCTTCTTATACCCTCTCCCAATGCCACCGCAGAAGTGGGTTACAAT
AGGGACAGGTTCCTTTTTAACCCTTCTGCCTGCCTCGATGAACACTTAATGCAGTTTAAG
TTTTTAGGAATTTTAATGGGGGTTGCCATTCGCACAAAGAAGCCTCTGGACCTCCACTTG
GCCCCTCTGGTGTGGAAGCAGCTGTGCTGTGTCCCACTCACCCTAGAGGACCTGGAGGAG
GTGGATCTGCTCTACGTGCAGACTCTCAACAGCATTCTTCACATTGAAGACAGTGGGATT
ACCGAGGAGAGTTTCCATGAGATGATTCCTCTTGATTCTTTTGTTGGCCAGAGTGCTGAT
GGCAAAATGGTTCCTATAATCCCTGGTGGAAATAGTATCCCACTCACATTTTCCAACAGG
AAGGAATATGTGGAGAGGGCCATTGAATATCGACTTCATGAGATGGACAGACAGGTGGCT
GCAGTCCGAGAAGGGATGTCCTGGATTGTTCCTGTGCCGCTGCTGTCCCTCCTCACAGCA
AAACAACTGGAGCAGATGGTGTGTGGGATGCCCGAGATCTCTGTGGAAGTCTTGAAGAAA
GTGGTGCGGTACCGTGAGGTGGATGAGCAGCATCAGCTGGTGCAGTGGTTCTGGCACACG
CTGGAAGAGTTCTCCAATGAGGAGCGGGTGCTTTTCATGAGGTTTGTGTCAGGAAGATCT
CGACTACCAGCCAACACTGCTGACATTTCTCAGAGATTTCAAATCATGAAGGTTGATAGG
CCTTACGACAGTCTGCCTACCTCACAGACCTGCTTCTTCCAGCTGAGGCTGCCCCCGTAC
TCCAGCCAGCTGGTCATGGCCGAGCGCCTGCGCTATGCCATCAACAACTGCCGCTCAATC
GACATGGACAACTACATGCTCTCGAGAAACGTGGACAACGCCGAGGGCTCCGACACTGAC
TACTGA
Protein Properties
Number of Residues 4861
Molecular Weight 532223.1
Theoretical pI 5.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Probable E3 ubiquitin-protein ligase HERC1
MATMIPPVKLKWLEHLNSSWITEDSESIATREGVAVLYSKLVSNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVHTMEKGKLLSSQEGMISFDCFM
TILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDVSIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHSFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAADLLEDQELQWPLHGGPELIDPAGLPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEIAVYVDLALGCSKEPARSLWISMQDYAVSKDWDSATLSNESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKHLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWISENQDSADVDPQEHSFTRTIDEEAEMEEQAERDREEGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRDRDRMNSGAGSGARADDPPPQSQQERRVSTDLPEGQDVYTA
ACNSVIHRCALLILGVSPVIDELQKRREEGQLQQPSTSASEGGGLMTRSESLTAESRLVH
TSPNYRLIKSRSESDLSQPESDEEGYALSGRRNVDLDLAASHRKRGPMHSQLESLSDSWA
RLKHSRDWLCNSSYSFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSP
QASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGSISLAGSRLSSGFQSSTLLTSVRLQ
FLAGCFGLGTVGHTGGKGESGRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERAL
QANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLP
KTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQTGVLH
MASFGEGEQEDGEEEEKKVDSSGETEKKDFRAALRKQHAAELHLGDFLVFLRRVVSSKAI
QSKMASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQI
VERLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKA
QCCLVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDF
NHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLA
FEDVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLI
RILHRTDRWTYCINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMREEKESKEEEK
GKHTRHGLADLSELQLRTLCIEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVVKE
GSTSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTYLT
GVHEDMGKQSTKRHEKKHRHESEEKGDVEQKPESESALDMRTGLTSDDVKSQSTTSSKSE
NEIASFSLDPTLPSVESQHQITEGKRKNHEHMSKNHDVAQSEIRAVQLSYLYLGAMKSLS
ALLGCSKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPI
KRALGLADLERAQAMIYKLVVHGLLEDQFGGKIKQEIDQQAEESDPAQQAQTPVTTSPSA
SSTTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQ
TPPISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLSTSPPPPAIAVPLLEM
GFSLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEEPQSGSTADSRPGAAVLG
SGGKSNDPCYLQSPGDIPSADAAEMEEGFSESPDNLDHTENAASGSGPSARGRSAVTRRH
KFDLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAME
AMFGQDLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCECSVVSFNQHMKRNHP
GCGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGTCREKYLAMKTKSKSTSSERYKG
QAPDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDP
LGASVAMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAA
AQVLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPS
AMASTSERSRGGHSKANKPISCLAYLSTAVGCLASNAPSAAKLLVQLCTQNLISAATGVN
LTTVDDSIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKSEVEK
KGPLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTTLQTLADMGGDLRKCS
FIKLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEGDAEES
LGSPSDPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSALAWPEEGPAT
AWSGESPELLLVGRMDGSLGLIEVVDVSTMHRRELEHCYRKDVSVTCIAWFSEDRPFAVG
YFDGKLLLGTKEPLEKGGIVLIDAHKDTLISMKWDPTGHILMTCAKEDSVKLWGSISGCW
CCLHSLCHPSIVNGIAWCRLPGKGSKLQLLMATGCQSGLVCVWRIPQDTTQTNVTSAEGW
WEQESNCQDGYRKSSGAKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGS
VLQTVVIGSGAIQTTVWIPEVGVAACSNRSKDVLVVNCTAEWAAANHVLATCRTALKQQG
VLGLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLL
CNPPVPPHHQNCLPDPASWNPNEWAWLECFSTTIKAAEALTNGAQFPESFTVPDLEPVPE
DELVFLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVP
AAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFV
VTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMS
CGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLA
VSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHV
YTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSE
GQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPD
TVPPQYGALREVSIHTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQ
GQLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKL
NASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNATAEVGYN
RDRFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCVPLTLEDLEE
VDLLYVQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNR
KEYVERAIEYRLHEMDRQVAAVREGMSWIVPVPLLSLLTAKQLEQMVCGMPEISVEVLKK
VVRYREVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDR
PYDSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLSRNVDNAEGSDTD
Y
GenBank ID Protein 126131099
UniProtKB/Swiss-Prot ID Q15751
UniProtKB/Swiss-Prot Entry Name HERC1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003922.3
GeneCard ID HERC1
GenAtlas ID HERC1
HGNC ID HGNC:4867
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  9. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  10. Garcia-Gonzalo FR, Cruz C, Munoz P, Mazurek S, Eigenbrodt E, Ventura F, Bartrons R, Rosa JL: Interaction between HERC1 and M2-type pyruvate kinase. FEBS Lett. 2003 Mar 27;539(1-3):78-84. [PubMed:12650930 ]
  11. Rosa JL, Casaroli-Marano RP, Buckler AJ, Vilaro S, Barbacid M: p619, a giant protein related to the chromosome condensation regulator RCC1, stimulates guanine nucleotide exchange on ARF1 and Rab proteins. EMBO J. 1996 Aug 15;15(16):4262-73. [PubMed:8861955 ]
  12. Garcia-Gonzalo FR, Bartrons R, Ventura F, Rosa JL: Requirement of phosphatidylinositol-4,5-bisphosphate for HERC1-mediated guanine nucleotide release from ARF proteins. FEBS Lett. 2005 Jan 17;579(2):343-8. [PubMed:15642342 ]
  13. Rosa JL, Barbacid M: A giant protein that stimulates guanine nucleotide exchange on ARF1 and Rab proteins forms a cytosolic ternary complex with clathrin and Hsp70. Oncogene. 1997 Jul 3;15(1):1-6. [PubMed:9233772 ]
  14. Garcia-Gonzalo FR, Munoz P, Gonzalez E, Casaroli-Marano RP, Vilaro S, Bartrons R, Ventura F, Rosa JL: The giant protein HERC1 is recruited to aluminum fluoride-induced actin-rich surface protrusions in HeLa cells. FEBS Lett. 2004 Feb 13;559(1-3):77-83. [PubMed:14960311 ]
  15. Chong-Kopera H, Inoki K, Li Y, Zhu T, Garcia-Gonzalo FR, Rosa JL, Guan KL: TSC1 stabilizes TSC2 by inhibiting the interaction between TSC2 and the HERC1 ubiquitin ligase. J Biol Chem. 2006 Mar 31;281(13):8313-6. Epub 2006 Feb 7. [PubMed:16464865 ]