You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08448
Secondary Accession Numbers
  • 14160
Name Protein-cysteine N-palmitoyltransferase HHAT
Synonyms
  1. Hedgehog acyltransferase
  2. MART-2
  3. Melanoma antigen recognized by T-cells 2
  4. Skinny hedgehog protein 1
Gene Name HHAT
Protein Type Unknown
Biological Properties
General Function Cell wall/membrane/envelope biogenesis
Specific Function Catalyzes N-terminal palmitoylation of SHH; which is required for SHH signaling. May bind GTP
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32
SNPs HHAT
Gene Sequence
>1482 bp
ATGCCGCCCCGATGGGAACTGGCACTTTACCTACTTGCCTCACTAGGCTTCCACTTCTAT
TCCTTCTATGAAGTTTACAAAGTCTCCAGAGAACACGAAGAGGAGCTGGACCAGGAATTT
GAGCTGGAGACTGACACTTTATTTGGAGGATTAAAGAAGGATGCGACCGACTTTGAGTGG
AGCTTCTGGATGGAATGGGGGAAGCAGTGGCTGGTGTGGCTTCTCCTTGGCCACATGGTA
GTGTCTCAAATGGCCACACTGCTGGCAAGAAAGCACAGACCCTGGATTCTCATGCTCTAT
GGGATGTGGGCCTGCTGGTGTGTGCTGGGGACCCCTGGTGTGGCTATGGTTTTGCTCCAT
ACCACCATCTCTTTCTGCGTGGCCCAGTTCCGGTCTCAGCTCCTGACGTGGCTCTGTTCT
CTCCTCCTCCTCTCCACACTGAGGCTGCAGGGTGTGGAAGAAGTTAAGAGAAGGTGGTAC
AAGACAGAAAACGAGTACTACCTGCTGCAGTTCACGCTGACCGTTCGCTGCCTCTACTAC
ACCAGCTTCAGCCTGGAGCTCTGCTGGCAGCAGCTGCCTGCTGCATCGACCTCCTACTCC
TTTCCCTGGATGCTGGCCTATGTCTTTTATTATCCAGTCTTACACAATGGGCCCATCCTC
AGCTTCTCGGAGTTCATCAAACAGATGCAGCAGCAGGAGCATGACTCCCTGAAGGCCAGC
CTGTGTGTCCTGGCCCTGGGGCTGGGCCGCCTTCTTTGCTGGTGGTGGCTGGCCGAGCTG
ATGGCTCACCTGATGTACATGCATGCCATCTACAGCAGCATCCCCCTCCTGGAGACTGTC
TCTTGTTGGACCTTAGGAGGACTGGCGTTAGCCCAGGTGCTCTTTTTCTACGTGAAGTAC
TTGGTGCTCTTTGGCGTGCCTGCTCTGCTCATGCGCCTGGATGGACTCACTCCACCCGCC
CTCCCCCGCTGCGTGAGCACCATGTTCAGTTTCACCGGGATGTGGAGGTATTTTGATGTT
GGACTGCATAATTTCTTAATCAGGTATGTGTACATTCCAGTGGGCGGGTCCCAGCATGGC
CTGCTGGGGACACTGTTTTCCACGGCGATGACATTTGCATTTGTGAGCTACTGGCATGGC
GGCTACGACTACCTCTGGTGCTGGGCAGCGCTCAACTGGCTGGGAGTCACTGTGGAGAAT
GGAGTCCGGAGGCTGGTGGAGACTCCCTGCATCCAGGACAGTCTGGCCCGATACTTCTCC
CCACAAGCTCGCCGTCGATTCCACGCTGCCCTTGCTTCTTGTTCCACCTCGATGCTGATC
CTGTCCAACCTGGTATTTCTTGGGGGCGATGAGGTTGGGAAAACCTACTGGAATAGGATC
TTCATACAAGGCTGGCCTTGGGTGACCCTCTCTGTCCTGGGATTCCTGTACTGCTACTCC
CACGTGGGCATTGCCTGGGCCCAGACCTACGCCACGGACTAA
Protein Properties
Number of Residues 493
Molecular Weight 57312.6
Theoretical pI 7.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 5-25
  • 69-89
  • 95-115
  • 133-152
  • 200-220
  • 251-271
  • 290-310
  • 360-380
  • 429-449
  • 467-487
Protein Sequence
>Protein-cysteine N-palmitoyltransferase HHAT
MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEW
SFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLH
TTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYY
TSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKAS
LCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKY
LVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHG
LLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFS
PQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYS
HVGIAWAQTYATD
GenBank ID Protein 7022931
UniProtKB/Swiss-Prot ID Q5VTY9
UniProtKB/Swiss-Prot Entry Name HHAT_HUMAN
PDB IDs Not Available
GenBank Gene ID AK001586
GeneCard ID HHAT
GenAtlas ID HHAT
HGNC ID HGNC:18270
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Kawakami Y, Wang X, Shofuda T, Sumimoto H, Tupesis J, Fitzgerald E, Rosenberg S: Isolation of a new melanoma antigen, MART-2, containing a mutated epitope recognized by autologous tumor-infiltrating T lymphocytes. J Immunol. 2001 Feb 15;166(4):2871-7. [PubMed:11160356 ]
  6. Chamoun Z, Mann RK, Nellen D, von Kessler DP, Bellotto M, Beachy PA, Basler K: Skinny hedgehog, an acyltransferase required for palmitoylation and activity of the hedgehog signal. Science. 2001 Sep 14;293(5537):2080-4. Epub 2001 Aug 2. [PubMed:11486055 ]