You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08449
Secondary Accession Numbers
  • 14161
Name Eukaryotic translation initiation factor 2 subunit 2
Synonyms
  1. Eukaryotic translation initiation factor 2 subunit beta
  2. eIF-2-beta
Gene Name EIF2S2
Protein Type Unknown
Biological Properties
General Function Involved in translation initiation factor activity
Specific Function eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
translation initiation factor activity
nucleic acid binding
translation factor activity, nucleic acid binding
rna binding
Process
translational initiation
cellular process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:2
Locus 20pter-q12
SNPs EIF2S2
Gene Sequence
>1002 bp
ATGTCTGGGGACGAGATGATTTTTGATCCTACTATGAGCAAGAAGAAAAAGAAGAAGAAG
AAGCCTTTTATGTTAGATGAGGAAGGGGATACCCAAACAGAGGAAACCCAGCCTTCAGAA
ACAAAAGAAGTGGAGCCAGAGCCAACTGAGGACAAGGATTTGGAAGCTGATGAAGAGGAC
ACTAGGAAAAAAGATGCTTCTGATGATCTAGATGACTTGAACTTCTTTAATCAAAAGAAA
AAGAAGAAAAAAACTAAAAAGATATTTGATATTGATGAAGCTGAAGAAGGTGTAAAGGAT
CTTAAGATTGAAAGTGATGTTCAAGAACCAACTGAACCAGAGGATGACCTTGACATTATG
CTTGGCAATAAAAAGAAGAAAAAGAAGAATGTTAAGTTCCCAGATGAGGATGAAATACTA
GAGAAAGATGAAGCTCTAGAAGATGAAGACAACAAAAAAGATGATGGTATCTCATTCAGT
AATCAGACAGGCCCTGCTTGGGCAGGCTCAGAAAGAGACTACACATACGAGGAGCTGCTG
AATCGAGTGTTCAACATCATGAGGGAAAAGAATCCAGATATGGTTGCTGGGGAGAAAAGG
AAATTTGTCATGAAACCTCCACAAGTCGTCCGAGTAGGAACCAAGAAAACTTCTTTTGTC
AACTTTACAGATATCTGTAAACTATTACATCGTCAGCCCAAACATCTCCTTGCATTTTTG
TTGGCTGAATTGGGTACAAGTGGTTCTATAGATGGTAATAACCAACTTGTAATCAAAGGA
AGATTCCAACAGAAACAGATAGAAAATGTCTTGAGAAGATATATCAAGGAATATGTCACT
TGTCACACATGCCGATCACCGGACACAATCCTGCAGAAGGACACACGACTCTATTTCCTA
CAGTGCGAAACTTGTCATTCTAGATGTTCTGTTGCCAGTATCAAAACCGGCTTCCAGGCT
GTCACGGGCAAGCGAGCACAGCTCCGTGCCAAAGCTAACTAA
Protein Properties
Number of Residues 333
Molecular Weight 38388.1
Theoretical pI 5.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic translation initiation factor 2 subunit 2
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
GenBank ID Protein 4938295
UniProtKB/Swiss-Prot ID P20042
UniProtKB/Swiss-Prot Entry Name IF2B_HUMAN
PDB IDs Not Available
GenBank Gene ID AL031668
GeneCard ID EIF2S2
GenAtlas ID EIF2S2
HGNC ID HGNC:3266
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  9. Pathak VK, Nielsen PJ, Trachsel H, Hershey JW: Structure of the beta subunit of translational initiation factor eIF-2. Cell. 1988 Aug 26;54(5):633-9. [PubMed:3044606 ]