You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08471
Secondary Accession Numbers
  • 14183
Name Ras GTPase-activating-like protein IQGAP1
Synonyms
  1. p195
Gene Name IQGAP1
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activator activity
Specific Function Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
ras gtpase activator activity
enzyme regulator activity
protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
enzyme activator activity
gtpase activator activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 15q26.1
SNPs IQGAP1
Gene Sequence
>4974 bp
ATGTCCGCCGCAGACGAGGTTGACGGGCTGGGCGTGGCCCGGCCGCACTATGGCTCTGTC
CTGGATAATGAAAGACTTACTGCAGAGGAGATGGATGAAAGGAGACGTCAGAACGTGGCT
TATGAGTACCTTTGTCATTTGGAAGAAGCGAAGAGGTGGATGGAAGCATGCCTAGGGGAA
GATCTGCCTCCCACCACAGAACTGGAGGAGGGGCTTAGGAATGGGGTCTACCTTGCCAAA
CTGGGGAACTTCTTCTCTCCCAAAGTAGTGTCCCTGAAAAAAATCTATGATCGAGAACAG
ACCAGATACAAGGCGACTGGCCTCCACTTTAGACACACTGATAATGTGATTCAGTGGTTG
AATGCCATGGATGAGATTGGATTGCCTAAGATTTTTTACCCAGAAACTACAGATATCTAT
GATCGAAAGAACATGCCAAGATGTATCTACTGTATCCATGCACTCAGTTTGTACCTGTTC
AAGCTAGGCCTGGCCCCTCAGATTCAAGACCTATATGGAAAGGTTGACTTCACAGAAGAA
GAAATCAACAACATGAAGACTGAGTTGGAGAAGTATGGCATCCAGATGCCTGCCTTTAGC
AAGATTGGGGGCATCTTGGCTAATGAACTGTCAGTGGATGAAGCCGCATTACATGCTGCT
GTTATTGCTATTAATGAAGCTATTGACCGTAGAATTCCAGCCGACACATTTGCAGCTTTG
AAAAATCCGAATGCCATGCTTGTAAATCTTGAAGAGCCCTTGGCATCCACTTACCAGGAT
ATACTTTACCAGGCTAAGCAGGACAAAATGACAAATGCTAAAAACAGGACAGAAAACTCA
GAGAGAGAAAGAGATGTTTATGAGGAGCTGCTCACGCAAGCTGAAATTCAAGGCAATATA
AACAAAGTCAATACATTTTCTGCATTAGCAAATATCGACCTGGCTTTAGAACAAGGAGAT
GCACTGGCCTTGTTCAGGGCTCTGCAGTCACCAGCCCTGGGGCTTCGAGGACTGCAGCAA
CAGAATAGCGACTGGTACTTGAAGCAGCTCCTGAGTGATAAACAGCAGAAGAGACAGAGT
GGTCAGACTGACCCCCTGCAGAAGGAGGAGCTGCAGTCTGGAGTGGATGCTGCAAACAGT
GCTGCCCAGCAATATCAGAGAAGATTGGCAGCAGTAGCACTGATTAATGCTGCAATCCAG
AAGGGTGTTGCTGAGAAGACTGTTTTGGAACTGATGAATCCCGAAGCCCAGCTGCCCCAG
GTGTATCCATTTGCCGCCGATCTCTATCAGAAGGAGCTGGCTACCCTGCAGCGACAAAGT
CCTGAACATAATCTCACCCACCCAGAGCTCTCTGTCGCAGTGGAGATGTTGTCATCGGTG
GCCCTGATCAACAGGGCATTGGAATCAGGAGATGTGAATACAGTGTGGAAGCAATTGAGC
AGTTCAGTTACTGGTCTTACCAATATTGAGGAAGAAAACTGTCAGAGGTATCTCGATGAG
TTGATGAAACTGAAGGCTCAGGCACATGCAGAGAATAATGAATTCATTACATGGAATGAT
ATCCAAGCTTGCGTGGACCATGTGAACCTGGTGGTGCAAGAGGAACATGAGAGGATTTTA
GCCATTGGTTTAATTAATGAAGCCCTGGATGAAGGTGATGCCCAAAAGACTCTGCAGGCC
CTACAGATTCCTGCAGCTAAACTTGAGGGAGTCCTTGCAGAAGTGGCCCAGCATTACCAA
GACACGCTGATTAGAGCGAAGAGAGAGAAAGCCCAGGAAATCCAGGATGAGTCAGCTGTG
TTATGGTTGGATGAAATTCAAGGTGGAATCTGGCAGTCCAACAAAGACACCCAAGAAGCA
CAGAAGTTTGCCTTAGGAATCTTTGCCATTAATGAGGCAGTAGAAAGTGGTGATGTTGGC
AAAACACTGAGTGCCCTTCGCTCCCCTGATGTTGGCTTGTATGGAGTCATCCCTGAGTGT
GGTGAAACTTACCACAGTGATCTTGCTGAAGCCAAGAAGAAAAAACTGGCAGTAGGAGAT
AATAACAGCAAGTGGGTGAAGCACTGGGTAAAAGGTGGATATTATTATTACCACAATCTG
GAGACCCAGGAAGGAGGATGGGATGAACCTCCAAATTTTGTGCAAAATTCTATGCAGCTT
TCTCGGGAGGAGATCCAGAGTTCTATCTCTGGGGTGACTGCCGCATATAACCGAGAACAG
CTGTGGCTGGCCAATGAAGGCCTGATCACCAGGCTGCAGGCTCGCTGCCGTGGATACTTA
GTTCGACAGGAATTCCGATCCAGGATGAATTTCCTGAAGAAACAAATCCCTGCCATCACC
TGCATTCAGTCACAGTGGAGAGGATACAAGCAGAAGAAGGCATATCAAGATCGGTTAGCT
TACCTGCGCTCCCACAAAGATGAAGTTGTAAAGATTCAGTCCCTGGCAAGGATGCACCAA
GCTCGAAAGCGCTATCGAGATCGCCTGCAGTACTTCCGGGACCATATAAATGACATTATC
AAAATCCAGGCTTTTATTCGGGCAAACAAAGCTCGGGATGACTACAAGACTCTCATCAAT
GCTGAGGATCCTCCTATGGTTGTGGTCCGAAAATTTGTCCACCTGCTGGACCAAAGTGAC
CAGGATTTTCAGGAGGAGCTTGACCTTATGAAGATGCGGGAAGAGGTTATCACCCTCATT
CGTTCTAACCAGCAGCTGGAGAATGACCTCAATCTCATGGATATCAAAATTGGACTGCTA
GTGAAAAATAAGATTACGTTGCAGGATGTGGTTTCCCACAGTAAAAAACTTACCAAAAAA
AATAAGGAACAGTTGTCTGATATGATGATGATAAATAAACAGAAGGGAGGTCTCAAGGCT
TTGAGCAAGGAGAAGAGAGAGAAGTTGGAAGCTTACCAGCACCTGTTTTATTTATTGCAA
ACCAATCCCACCTATCTGGCCAAGCTCATTTTTCAGATGCCCCAGAACAAGTCCACCAAG
TTCATGGACTCTGTAATCTTCACACTCTACAACTACGCGTCCAACCAGCGAGAGGAGTAC
CTGCTCCTGCGGCTCTTTAAGACAGCACTCCAAGAGGAAATCAAGTCGAAGGTAGATCAG
ATTCAAGAGATTGTGACAGGAAATCCTACGGTTATTAAAATGGTTGTAAGTTTCAACCGT
GGTGCCCGTGGCCAGAATGCCCTGAGACAGATCTTGGCCCCAGTCGTGAAGGAAATTATG
GATGACAAATCTCTCAACATCAAAACTGACCCTGTGGATATTTACAAATCTTGGGTTAAT
CAGATGGAGTCTCAGACAGGAGAGGCAAGCAAACTGCCCTATGATGTGACCCCTGAGCAG
GCGCTAGCTCATGAAGAAGTGAAGACACGGCTAGACAGCTCCATCAGGAACATGCGGGCT
GTGACAGACAAGTTTCTCTCAGCCATTGTCAGCTCTGTGGACAAAATCCCTTATGGGATG
CGCTTCATTGCCAAAGTGCTGAAGGACTCGTTGCATGAGAAGTTCCCTGATGCTGGTGAG
GATGAGCTGCTGAAGATTATTGGTAACTTGCTTTATTATCGATACATGAATCCAGCCATT
GTTGCTCCTGATGCCTTTGACATCATTGACCTGTCAGCAGGAGGCCAGCTTACCACAGAC
CAACGCCGAAATCTGGGCTCCATTGCAAAAATGCTTCAGCATGCTGCTTCCAATAAGATG
TTTCTGGGAGATAATGCCCACTTAAGCATCATTAATGAATATCTTTCCCAGTCCTACCAG
AAATTCAGACGGTTTTTCCAAACTGCTTGTGATGTCCCAGAGCTTCAGGATAAATTTAAT
GTGGATGAGTACTCTGATTTAGTAACCCTCACCAAACCAGTAATCTACATTTCCATTGGT
GAAATCATCAACACCCACACTCTCCTGTTGGATCACCAGGATGCCATTGCTCCGGAGCAC
AATGATCCAATCCACGAACTGCTGGACGACCTCGGCGAGGTGCCCACCATCGAGTCCCTG
ATAGGGGAAAGCTCTGGCAATTTAAATGACCCAAATAAGGAGGCACTGGCTAAGACGGAA
GTGTCTCTCACCCTGACCAACAAGTTCGACGTGCCTGGAGATGAGAATGCAGAAATGGAT
GCTCGAACCATCTTACTGAATACAAAACGTTTAATTGTGGATGTCATCCGGTTCCAGCCA
GGAGAGACCTTGACTGAAATCCTAGAAACACCAGCCACCAGTGAACAGGAAGCAGAACAT
CAGAGAGCCATGCAGAGACGTGCTATCCGTGATGCCAAAACACCTGACAAGATGAAAAAG
TCAAAATCTGTAAAGGAAGACAGCAACCTCACTCTTCAAGAGAAGAAAGAGAAGATCCAG
ACAGGTTTAAAGAAGCTAACAGAGCTTGGAACCGTGGACCCAAAGAACAAATACCAGGAA
CTGATCAACGACATTGCCAGGGATATTCGGAATCAGCGGAGGTACCGACAGAGGAGAAAG
GCCGAACTAGTGAAACTGCAACAGACATACGCTGCTCTGAACTCTAAGGCCACCTTTTAT
GGGGAGCAGGTGGATTACTATAAAAGCTATATCAAAACCTGCTTGGATAACTTAGCCAGC
AAGGGCAAAGTCTCCAAAAAGCCTAGGGAAATGAAAGGAAAGAAAAGCAAAAAGATTTCT
CTGAAATATACAGCAGCAAGACTACATGAAAAAGGAGTTCTTCTGGAAATTGAGGACCTG
CAAGTGAATCAGTTTAAAAATGTTATATTTGAAATCAGTCCAACAGAAGAAGTTGGAGAC
TTCGAAGTGAAAGCCAAATTCATGGGAGTTCAAATGGAGACTTTTATGTTACATTATCAG
GACCTGCTGCAGCTACAGTATGAAGGAGTTGCAGTCATGAAATTATTTGATAGAGCTAAA
GTAAATGTCAACCTCCTGATCTTCCTTCTCAACAAAAAGTTCTACGGGAAGTAA
Protein Properties
Number of Residues 1657
Molecular Weight 189250.4
Theoretical pI 6.43
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras GTPase-activating-like protein IQGAP1
MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFAAL
KNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC
GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQL
SREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRA
VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
SKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
GenBank ID Protein 156230796
UniProtKB/Swiss-Prot ID P46940
UniProtKB/Swiss-Prot Entry Name IQGA1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC151834
GeneCard ID IQGAP1
GenAtlas ID IQGAP1
HGNC ID HGNC:6110
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  8. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  9. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  10. Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1994;1(5):223-9. [PubMed:7584044 ]
  11. Morita E, Sandrin V, Chung HY, Morham SG, Gygi SP, Rodesch CK, Sundquist WI: Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis. EMBO J. 2007 Oct 3;26(19):4215-27. Epub 2007 Sep 13. [PubMed:17853893 ]
  12. Weissbach L, Settleman J, Kalady MF, Snijders AJ, Murthy AE, Yan YX, Bernards A: Identification of a human rasGAP-related protein containing calmodulin-binding motifs. J Biol Chem. 1994 Aug 12;269(32):20517-21. [PubMed:8051149 ]
  13. Grohmanova K, Schlaepfer D, Hess D, Gutierrez P, Beck M, Kroschewski R: Phosphorylation of IQGAP1 modulates its binding to Cdc42, revealing a new type of rho-GTPase regulator. J Biol Chem. 2004 Nov 19;279(47):48495-504. Epub 2004 Sep 7. [PubMed:15355962 ]
  14. Li Z, McNulty DE, Marler KJ, Lim L, Hall C, Annan RS, Sacks DB: IQGAP1 promotes neurite outgrowth in a phosphorylation-dependent manner. J Biol Chem. 2005 Apr 8;280(14):13871-8. Epub 2005 Jan 28. [PubMed:15695813 ]
  15. Hart MJ, Callow MG, Souza B, Polakis P: IQGAP1, a calmodulin-binding protein with a rasGAP-related domain, is a potential effector for cdc42Hs. EMBO J. 1996 Jun 17;15(12):2997-3005. [PubMed:8670801 ]