You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08475
Secondary Accession Numbers
  • 14187
Name Kinesin-like protein KIF20A
Synonyms
  1. GG10_2
  2. Rab6-interacting kinesin-like protein
  3. Rabkinesin-6
Gene Name KIF20A
Protein Type Unknown
Biological Properties
General Function Involved in microtubule motor activity
Specific Function Interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B. May act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. Has a microtubule plus end-directed motility
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
hydrolase activity
motor activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
microtubule motor activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
cellular process
microtubule-based process
microtubule-based movement
Cellular Location
  1. Golgi apparatus
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31
SNPs KIF20A
Gene Sequence
>2673 bp
ATGTCGCAAGGGATCCTTTCTCCGCCAGCGGGCTTGCTGTCCGATGACGATGTCGTAGTT
TCTCCCATGTTTGAGTCCACAGCTGCAGATTTGGGGTCTGTGGTACGCAAGAACCTGCTA
TCAGACTGCTCTGTCGTCTCTACCTCCCTAGAGGACAAGCAGCAGGTTCCATCTGAGGAC
AGTATGGAGAAGGTGAAAGTATACTTGAGGGTTAGGCCCTTGTTACCTTCAGAGTTGGAA
CGACAGGAAGATCAGGGTTGTGTCCGTATTGAGAATGTGGAGACCCTTGTTCTACAAGCA
CCCAAGGACTCGTTTGCCCTGAAGAGCAATGAACGGGGAATTGGCCAAGCCACACACAGG
TTCACCTTTTCCCAGATCTTTGGGCCAGAAGTGGGACAGGCATCCTTCTTCAACCTAACT
GTGAAGGAGATGGTAAAGGATGTACTCAAAGGGCAGAACTGGCTCATCTATACATATGGA
GTCACTAACTCAGGGAAAACCCACACGATTCAAGGTACCATCAAGGATGGAGGGATTCTC
CCCCGGTCCCTGGCGCTGATCTTCAATAGCCTCCAAGGCCAACTTCATCCAACACCTGAT
CTGAAGCCCTTGCTCTCCAATGAGGTAATCTGGCTAGACAGCAAGCAGATCCGACAGGAG
GAAATGAAGAAGCTGTCCCTGCTAAATGGAGGCCTCCAAGAGGAGGAGCTGTCCACTTCC
TTGAAGAGGAGTGTCTACATCGAAAGTCGGATAGGTACCAGCACCAGCTTCGACAGTGGC
ATTGCTGGGCTCTCTTCTATCAGTCAGTGTACCAGCAGTAGCCAGCTGGATGAAACAAGT
CATCGATGGGCACAGCCAGACACTGCCCCACTACCTGTCCCGGCAAACATTCGCTTCTCC
ATCTGGATCTCATTCTTTGAGATCTACAACGAACTGCTTTATGACCTATTAGAACCGCCT
AGCCAACAGCGCAAGAGGCAGACTTTGCGGCTATGCGAGGATCAAAATGGCAATCCCTAT
GTGAAAGATCTCAACTGGATTCATGTGCAAGATGCTGAGGAGGCCTGGAAGCTCCTAAAA
GTGGGTCGTAAGAACCAGAGCTTTGCCAGCACCCACCTCAACCAGAACTCCAGCCGCAGT
CACAGCATCTTCTCAATCAGGATCCTACACCTTCAGGGGGAAGGAGATATAGTCCCCAAG
ATCAGCGAGCTGTCACTCTGTGATCTGGCTGGCTCAGAGCGCTGCAAAGATCAGAAGAGT
GGTGAACGGTTGAAGGAAGCAGGAAACATTAACACCTCTCTACACACCCTGGGCCGCTGT
ATTGCTGCCCTTCGTCAAAACCAGCAGAACCGGTCAAAGCAGAACCTGGTTCCCTTCCGT
GACAGCAAGTTGACTCGAGTGTTCCAAGGTTTCTTCACAGGCCGAGGCCGTTCCTGCATG
ATTGTCAATGTGAATCCCTGTGCATCTACCTATGATGAAACTCTTCATGTGGCCAAGTTC
TCAGCCATTGCTAGCCAGCTTGTGCATGCCCCACCTATGCAACTGGGATTCCCATCCCTG
CACTCGTTCATCAAGGAACATAGTCTTCAGGTATCCCCCAGCTTAGAGAAAGGGGCTAAG
GCAGACACAGGCCTTGATGATGATATTGAAAATGAAGCTGACATCTCCATGTATGGCAAA
GAGGAGCTCCTACAAGTTGTGGAAGCCATGAAGACACTGCTTTTGAAGGAACGACAGGAA
AAGCTACAGCTGGAGATGCATCTCCGAGATGAAATTTGCAATGAGATGGTAGAACAGATG
CAACAGCGGGAACAGTGGTGCAGTGAACATTTGGACACCCAAAAGGAACTATTGGAGGAA
ATGTATGAAGAAAAACTAAATATCCTCAAGGAGTCACTGACAAGTTTTTACCAAGAAGAG
ATTCAGGAGCGGGATGAAAAGATTGAAGAGCTAGAAGCTCTCTTGCAGGAAGCCAGACAA
CAGTCAGTGGCCCATCAGCAATCAGGGTCTGAATTGGCCCTACGGCGGTCACAAAGGTTG
GCAGCTTCTGCCTCCACCCAGCAGCTTCAGGAGGTTAAAGCTAAATTACAGCAGTGCAAA
GCAGAGCTAAACTCTACCACTGAAGAGTTGCATAAGTATCAGAAAATGTTAGAACCACCA
CCCTCAGCCAAGCCCTTCACCATTGATGTGGACAAGAAGTTAGAAGAGGGCCAGAAGAAT
ATAAGGCTGTTGCGGACAGAGCTTCAGAAACTTGGTGAGTCTCTCCAATCAGCAGAGAGA
GCTTGTTGCCACAGCACTGGGGCAGGAAAACTTCGTCAAGCCTTGACCACTTGTGATGAC
ATCTTAATCAAACAGGACCAGACTCTGGCTGAACTGCAGAACAACATGGTGCTAGTGAAA
CTGGACCTTCGGAAGAAGGCAGCATGTATTGCTGAGCAGTATCATACTGTGTTGAAACTC
CAAGGCCAGGTTTCTGCCAAAAAGCGCCTTGGTACCAACCAGGAAAATCAGCAACCAAAC
CAACAACCACCAGGGAAGAAACCATTCCTTCGAAATTTACTTCCCCGAACACCAACCTGC
CAAAGCTCAACAGACTGCAGCCCTTATGCCCGGATCCTACGCTCACGGCGTTCCCCTTTA
CTCAAATCTGGGCCTTTTGGCAAAAAGTACTAA
Protein Properties
Number of Residues 890
Molecular Weight 100277.1
Theoretical pI 6.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Kinesin-like protein KIF20A
MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSED
SMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHR
FTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGIL
PRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTS
LKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFS
IWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLK
VGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKS
GERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCM
IVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAK
ADTGLDDDIENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQM
QQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQ
QSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPP
PSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDD
ILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPN
QQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95235
UniProtKB/Swiss-Prot Entry Name KI20A_HUMAN
PDB IDs Not Available
GenBank Gene ID AF070672
GeneCard ID KIF20A
GenAtlas ID KIF20A
HGNC ID HGNC:9787
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  8. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  9. Horrevoets AJ, Fontijn RD, van Zonneveld AJ, de Vries CJ, ten Cate JW, Pannekoek H: Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes. Blood. 1999 May 15;93(10):3418-31. [PubMed:10233894 ]
  10. Lai F, Fernald AA, Zhao N, Le Beau MM: cDNA cloning, expression pattern, genomic structure and chromosomal location of RAB6KIFL, a human kinesin-like gene. Gene. 2000 May 2;248(1-2):117-25. [PubMed:10806357 ]