You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08487
Secondary Accession Numbers
  • 14199
Name Serine/threonine-protein kinase MRCK gamma
Synonyms
  1. CDC42-binding protein kinase gamma
  2. DMPK-like gamma
  3. MRCK gamma
  4. Myotonic dystrophy kinase-related CDC42-binding kinase gamma
  5. Myotonic dystrophy protein kinase-like alpha
  6. Myotonic dystrophy protein kinase-like gamma
Gene Name CDC42BPG
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
enzyme regulator activity
protein kinase activity
protein serine/threonine kinase activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
intracellular signaling pathway
signaling
signaling pathway
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.1
SNPs CDC42BPG
Gene Sequence
>4656 bp
ATGGAGCGGCGGCTGCGCGCGCTGGAGCAGCTGGCGCGGGGCGAGGCCGGCGGCTGCCCG
GGGCTCGACGGCCTCCTAGATCTGCTGCTGGCGCTGCACCACGAGCTCAGCAGCGGCCCC
CTACGGCGGGAGCGCAGCGTGGCGCAGTTCCTGAGCTGGGCCAGCCCCTTCGTATCAAAG
GTGAAAGAACTGCGTCTGCAGAGAGATGACTTTGAGATCTTGAAGGTGATCGGCCGAGGA
GCCTTTGGGGAGGTCACCGTGGTGAGGCAGAGGGACACTGGGCAGATTTTTGCCATGAAA
ATGCTGCACAAGTGGGAGATGCTGAAGAGGGCTGAGACAGCCTGTTTCCGGGAGGAGCGG
GATGTGCTCGTGAAAGGGGACAGCCGTTGGGTGACCACTCTGCACTATGCCTTCCAAGAC
GAGGAGTACCTGTACCTTGTGATGGACTACTATGCTGGTGGGGACCTCCTGACGCTGCTG
AGCCGCTTCGAGGACCGTCTCCCGCCCGAGCTGGCCCAGTTCTACCTGGCTGAGATGGTG
CTGGCCATCCACTCGCTGCACCAGCTGGGTTATGTCCACAGGGATGTCAAGCCAGACAAC
GTCCTGCTGGATGTGAACGGGCACATTCGCCTGGCTGACTTCGGCTCCTGCCTGCGTCTC
AACACCAACGGCATGGTGGATTCATCAGTGGCAGTAGGGACGCCGGACTATATCTCCCCT
GAGATCCTGCAGGCCATGGAGGAGGGCAAGGGCCACTACGGCCCACAGTGTGACTGGTGG
TCGCTTGGAGTCTGCGCCTATGAGCTGCTCTTTGGGGAGACGCCCTTCTATGCTGAGTCC
TTGGTGGAAACCTACGGCAAGATCATGAACCACGAGGACCACCTGCAGTTCCCCCCGGAC
GTGCCTGACGTGCCAGCCAGCGCCCAAGACCTGATCCGCCAGCTGCTGTGTCGCCAGGAA
GAGCGGCTAGGCCGTGGTGGGCTGGATGACTTCCGGAACCATCCTTTCTTCGAAGGCGTG
GACTGGGAGCGGCTGGCGAGCAGCACGGCCCCCTATATTCCTGAGCTGCGGGGGCCCATG
GACACCTCCAACTTTGATGTGGATGACGACACCCTCAACCATCCAGGGACCCTGCCACCG
CCCTCCCACGGGGCCTTCTCCGGCCATCACCTGCCATTCGTGGGCTTCACCTACACCTCA
GGCAGTCACAGTCCTGAGAGCAGCTCTGAGGCTTGGGCTGCCCTGGAGCGGAAGCTCCAG
TGTCTGGAGCAGGAGAAGGTGGAGCTGAGCAGGAAGCACCAAGAGGCCCTGCACGCCCCC
ACAGACCATCGGGAGCTGGAGCAGCTACGGAAGGAAGTGCAGACTCTGCGGGACAGGCTG
CCAGAGATGCTGAGGGACAAGGCCTCATTGTCCCAGACGGATGGGCCCCCAGCTGGTAGC
CCAGGTCAGGACAGTGACCTACGGCAGGAGCTTGACCGACTTCACCGGGAGCTGGCCGAG
GGTCGGGCAGGGCTGCAGGCTCAGGAGCAGGAGCTCTGCAGGGCCCAGGGGCAGCAGGAG
GAGCTGCTTCAGAGGCTACAGGAGGCCCAGGAGAGAGAGGCGGCCACAGCTAGCCAGACC
CGGGCCCTGAGCTCCCAGCTGGAGGAAGCCCGGGCTGCCCAGAGGGAGCTGGAGGCCCAG
GTGTCCTCCCTGAGCCGGCAGGTGACGCAGCTGCAGGGACAGTGGGAGCAACGCCTTGAG
GAGTCGTCCCAGGCCAAGACCATCCACACAGCCTCTGAGACCAACGGGATGGGACCCCCT
GAGGGTGGGCCTCAGGAGGCCCAACTGAGGAAGGAGGTGGCCGCCCTGCGAGAGCAGCTG
GAGCAGGCCCACAGCCACAGGCCGAGTGGTAAGGAGGAGGCTCTGTGCCAGCTGCAGGAG
GAAAACCGGAGGCTGAGCCGGGAGCAGGAGCGGCTAGAAGCAGAGCTGGCCCAGGAGCAG
GAGAGCAAGCAGCGGCTGGAGGGTGAGCGGCGGGAGACGGAGAGCAACTGGGAGGCCCAG
CTCGCCGACATCCTCAGCTGGGTGAATGATGAGAAGGTCTCAAGAGGCTACCTGCAGGCC
CTGGCCACCAAGATGGCAGAGGAGCTGGAGTCCTTGAGGAACGTAGGCACCCAGACGCTC
CCTGCCCGGCCACTGGACCACCAGTGGAAGGCGCGGCGACTGCAGAAGATGGAGGCCTCG
GCCAGGCTGGAGCTGCAGTCAGCGCTGGAGGCCGAGATCCGCGCCAAGCAGGGCCTGCAG
GAGCGGCTGACACAGGTGCAGGAGGCCCAGCTGCAGGCTGAGCGCCGTCTGCAGGAGGCC
GAGAAGCAGAGCCAGGCCCTGCAACAGGAGCTCGCCATGCTGCGGGAGGAGCTGCGGGCC
CGAGGGCCAGTGGACACCAAGCCCTCAAACTCCCTGATTCCCTTCCTGTCCTTCCGGAGC
TCAGAGAAGGATTCTGCCAAGGACCCTGGCATCTCAGGAGAGGCCACAAGGCATGGAGGA
GAGCCAGATCTGAGGCCGGAGGGCCGACGCAGCCTGCGCATGGGGGCTGTGTTCCCCAGA
GCACCCACTGCCAACACAGCCTCTACAGAAGGTCTTCCTGCTAAGCCCGGCTCACACACG
CTGCGCCCCCGGAGCTTCCCATCCCCGACCAAGTGTCTCCGCTGCACCTCGCTGATGCTG
GGCCTGGGCCGCCAGGGCCTGGGTTGTGATGCCTGCGGCTACTTTTGTCACACAACCTGT
GCCCCACAGGCCCCACCCTGCCCCGTGCCCCCTGACCTCCTCCGCACAGCCCTGGGAGTA
CACCCCGAAACAGGCACAGGCACTGCCTATGAGGGCTTTCTGTCGGTGCCGCGGCCCTCA
GGTGTCCGGCGGGGCTGGCAGCGCGTGTTTGCTGCCCTGAGTGACTCACGCCTGCTGCTG
TTTGACGCCCCTGACCTGAGGCTCAGCCCGCCCAGTGGGGCCCTCCTGCAGGTCCTAGAT
CTGAGGGACCCCCAGTTCTCGGCTACCCCTGTCCTGGCCTCTGATGTTATCCATGCCCAA
TCCAGGGACCTGCCACGCATCTTTAGGGTGACAACCTCCCAGCTGGCAGTGCCGCCCACC
ACGTGCACTGTGCTGCTGCTGGCAGAGAGCGAGGGGGAGCGGGAACGCTGGCTGCAGGTG
CTGGGTGAGCTGCAGCGGCTGCTGCTGGACGCGCGGCCAAGACCCCGGCCCGTGTACACA
CTCAAGGAGGCTTACGACAACGGGCTGCCGCTGCTGCCTCACACGCTCTGCGCTGCCATC
CTCGACCAGGATCGACTTGCGCTTGGCACCGAGGAGGGGCTCTTTGTCATCCATCTGCGC
AGCAACGACATCTTCCAGGTGGGGGAGTGCCGGCGCGTGCAGCAGCTGACCTTGAGCCCC
AGTGCAGGCCTGCTGGTCGTGCTGTGTGGCCGCGGCCCCAGCGTGCGTCTCTTTGCCCTG
GCGGAGCTGGAGAACATAGAGGTAGCAGGTGCCAAGATCCCCGAGTCTCGAGGCTGCCAG
GTGCTGGCAGCTGGAAGCATCCTGCAGGCCCGCACCCCGGTGCTCTGTGTAGCCGTCAAG
CGCCAGGTGCTCTGCTACCAGCTGGGCCCGGGCCCTGGGCCCTGGCAGCGCCGCATCCGT
GAGCTGCAGGCACCTGCCACTGTGCAGAGCCTGGGGCTGCTGGGCGACCGGCTATGTGTG
GGCGCCGCCGGTGGCTTTGCACTCTACCCGCTGCTCAACGAGGCTGCGCCGTTGGCGCTG
GGGGCCGGTTTGGTGCCTGAGGAGCTGCCACCATCCCGCGGGGGCCTGGGTGAGGCACTG
GGTGCCGTGGAGCTTAGCCTCAGCGAGTTCCTGCTACTCTTCACCACTGCTGGCATCTAC
GTGGATGGCGCAGGCCGCAAGTCTCGTGGCCACGAGCTGTTGTGGCCAGCAGCGCCCATG
GGCTGGGGGTATGCGGCCCCCTACCTGACAGTGTTCAGCGAGAACTCCATCGATGTGTTT
GACGTGAGGAGGGCAGAATGGGTGCAGACCGTGCCGCTCAAGAAGGTGCGGCCCCTCAAT
CCAGAGGGCTCCCTGTTCCTCTACGGCACCGAGAAGGTCCGCCTGACCTACCTCAGGAAC
CAGCTGGCAGAGAAGGACGAGTTCGACATCCCGGACCTCACCGACAACAGCCGGCGCCAG
CTGTTCCGCACCAAGAGCAAGCGCCGCTTCTTTTTCCGCGTGTCGGAGGAGCAGCAGAAG
CAGCAGCGCAGGGAGATGCTGAAGGACCCTTTTGTGCGCTCCAAGCTCATCTCGCCGCCT
ACCAACTTCAACCACCTAGTACACGTGGGCCCTGCCAACGGGCGGCCCGGCGCCAGGGAC
AAGTCCCCGGCTCCCGAAGAGAAGGGCCGAGTTGCCCGCGGCTCCGGCCCACAGCGGCCC
CACAGCTTCTCCGAGGCGTTGCGGCGCCCAGCCTCCATGGGCAGCGAAGGCCTCGGTGGA
GACGCAGACCCCATGAAGAGGAAACCCTGGACATCCCTGTCCAGCGAGTCTGTGTCCTGC
CCCCAGGGATCGCTGAGCCCTGCAACCTCCCTAATGCAGGTCTCAGAACGGCCCCGAAGC
CTCCCCCTATCCCCTGAATTGGAGAGCTCTCCTTGA
Protein Properties
Number of Residues 1551
Molecular Weight 172457.6
Theoretical pI 6.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase MRCK gamma
MERRLRALEQLARGEAGGCPGLDGLLDLLLALHHELSSGPLRRERSVAQFLSWASPFVSK
VKELRLQRDDFEILKVIGRGAFGEVTVVRQRDTGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTTLHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDVNGHIRLADFGSCLRLNTNGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPPD
VPDVPASAQDLIRQLLCRQEERLGRGGLDDFRNHPFFEGVDWERLASSTAPYIPELRGPM
DTSNFDVDDDTLNHPGTLPPPSHGAFSGHHLPFVGFTYTSGSHSPESSSEAWAALERKLQ
CLEQEKVELSRKHQEALHAPTDHRELEQLRKEVQTLRDRLPEMLRDKASLSQTDGPPAGS
PGQDSDLRQELDRLHRELAEGRAGLQAQEQELCRAQGQQEELLQRLQEAQEREAATASQT
RALSSQLEEARAAQRELEAQVSSLSRQVTQLQGQWEQRLEESSQAKTIHTASETNGMGPP
EGGPQEAQLRKEVAALREQLEQAHSHRPSGKEEALCQLQEENRRLSREQERLEAELAQEQ
ESKQRLEGERRETESNWEAQLADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTL
PARPLDHQWKARRLQKMEASARLELQSALEAEIRAKQGLQERLTQVQEAQLQAERRLQEA
EKQSQALQQELAMLREELRARGPVDTKPSNSLIPFLSFRSSEKDSAKDPGISGEATRHGG
EPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSHTLRPRSFPSPTKCLRCTSLML
GLGRQGLGCDACGYFCHTTCAPQAPPCPVPPDLLRTALGVHPETGTGTAYEGFLSVPRPS
GVRRGWQRVFAALSDSRLLLFDAPDLRLSPPSGALLQVLDLRDPQFSATPVLASDVIHAQ
SRDLPRIFRVTTSQLAVPPTTCTVLLLAESEGERERWLQVLGELQRLLLDARPRPRPVYT
LKEAYDNGLPLLPHTLCAAILDQDRLALGTEEGLFVIHLRSNDIFQVGECRRVQQLTLSP
SAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCVAVK
RQVLCYQLGPGPGPWQRRIRELQAPATVQSLGLLGDRLCVGAAGGFALYPLLNEAAPLAL
GAGLVPEELPPSRGGLGEALGAVELSLSEFLLLFTTAGIYVDGAGRKSRGHELLWPAAPM
GWGYAAPYLTVFSENSIDVFDVRRAEWVQTVPLKKVRPLNPEGSLFLYGTEKVRLTYLRN
QLAEKDEFDIPDLTDNSRRQLFRTKSKRRFFFRVSEEQQKQQRREMLKDPFVRSKLISPP
TNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGG
DADPMKRKPWTSLSSESVSCPQGSLSPATSLMQVSERPRSLPLSPELESSP
GenBank ID Protein 156766068
UniProtKB/Swiss-Prot ID Q6DT37
UniProtKB/Swiss-Prot Entry Name MRCKG_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_017525.2
GeneCard ID CDC42BPG
GenAtlas ID CDC42BPG
HGNC ID HGNC:29829
References
General References
  1. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  4. Kedra D, Seroussi E, Fransson I, Trifunovic J, Clark M, Lagercrantz J, Blennow E, Mehlin H, Dumanski J: The germinal center kinase gene and a novel CDC25-like gene are located in the vicinity of the PYGM gene on 11q13. Hum Genet. 1997 Oct;100(5-6):611-9. [PubMed:9341881 ]
  5. Ng Y, Tan I, Lim L, Leung T: Expression of the human myotonic dystrophy kinase-related Cdc42-binding kinase gamma is regulated by promoter DNA methylation and Sp1 binding. J Biol Chem. 2004 Aug 13;279(33):34156-64. Epub 2004 Jun 11. [PubMed:15194684 ]