You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08501
Secondary Accession Numbers
  • 14213
Name Partitioning defective 6 homolog beta
Synonyms
  1. PAR-6 beta
  2. PAR-6B
Gene Name PARD6B
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Adapter protein involved in asymmetrical cell division and cell polarization processes. Probably involved in formation of epithelial tight junctions. Association with PARD3 may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.13
SNPs PARD6B
Gene Sequence
>1119 bp
ATGAACCGCAGCCACCGGCACGGGGCGGGCAGCGGCTGCCTGGGCACTATGGAGGTGAAG
AGCAAGTTTGGAGCTGAATTTCGTCGGTTTTCGCTGGAAAGATCAAAACCTGGAAAATTT
GAGGAGTTTTATGGATTACTACAACATGTTCATAAGATCCCCAATGTTGACGTTTTGGTA
GGCTATGCAGACATCCATGGAGACTTACTACCTATAAATAATGATGATAATTATCACAAA
GCTGTTTCAACGGCCAATCCACTGCTTAGGATATTTATACAAAAGAAGGAAGAAGCAGAC
TACAGTGCCTTTGGTACAGACACGCTAATAAAGAAGAAGAATGTTTTAACCAACGTATTG
CGTCCTGACAACCATAGAAAAAAGCCACATATAGTCATTAGTATGCCCCAAGACTTTAGA
CCTGTGTCTTCTATTATAGACGTGGATATTCTCCCAGAAACGCATCGTAGGGTACGTCTT
TACAAATACGGCACGGAGAAACCCCTAGGATTCTACATCCGGGATGGCTCCAGTGTCAGG
GTAACACCACATGGCTTAGAAAAGGTTCCAGGGATCTTTATATCCAGGCTTGTCCCAGGA
GGTCTGGCTCAAAGTACAGGACTATTAGCTGTTAATGATGAAGTTTTAGAAGTTAATGGC
ATAGAAGTTTCAGGGAAGAGCCTTGATCAAGTAACAGACATGATGATTGCAAATAGCCGT
AACCTCATCATAACAGTGAGACCGGCAAACCAGAGGAATAATGTTGTGAGGAACAGTCGG
ACTTCTGGCAGTTCCGGTCAGTCTACTGATAACAGCCTTCTTGGCTACCCACAGCAGATT
GAACCAAGCTTTGAGCCAGAGGATGAAGACAGCGAAGAAGATGACATTATCATTGAAGAC
AATGGAGTGCCACAGCAGATTCCAAAAGCTGTTCCTAATACTGAGAGCCTGGAGTCATTA
ACACAGATAGAGCTAAGCTTTGAGTCTGGACAGAATGGCTTTATTCCCTCTAATGAAGTG
AGCTTAGCAGCCATAGCAAGCAGCTCAAACACGGAATTTGAAACACATGCTCCAGATCAA
AAACTCTTAGAAGAAGATGGAACAATCATAACATTATGA
Protein Properties
Number of Residues 372
Molecular Weight 41181.9
Theoretical pI 5.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Partitioning defective 6 homolog beta
MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIEPSFEPEDEDSEEDDIIIED
NGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSNTEFETHAPDQ
KLLEEDGTIITL
GenBank ID Protein 13537117
UniProtKB/Swiss-Prot ID Q9BYG5
UniProtKB/Swiss-Prot Entry Name PAR6B_HUMAN
PDB IDs
GenBank Gene ID AB044555
GeneCard ID PARD6B
GenAtlas ID PARD6B
HGNC ID HGNC:16245
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Noda Y, Takeya R, Ohno S, Naito S, Ito T, Sumimoto H: Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C. Genes Cells. 2001 Feb;6(2):107-19. [PubMed:11260256 ]
  4. Gao L, Macara IG, Joberty G: Multiple splice variants of Par3 and of a novel related gene, Par3L, produce proteins with different binding properties. Gene. 2002 Jul 10;294(1-2):99-107. [PubMed:12234671 ]
  5. Yamanaka T, Horikoshi Y, Sugiyama Y, Ishiyama C, Suzuki A, Hirose T, Iwamatsu A, Shinohara A, Ohno S: Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity. Curr Biol. 2003 Apr 29;13(9):734-43. [PubMed:12725730 ]