You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08504
Secondary Accession Numbers
  • 14216
Name Phosducin-like protein
Synonyms
  1. PHLP
Gene Name PDCL
Protein Type Unknown
Biological Properties
General Function Involved in response to stimulus
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:9
Locus 9q12-q13
SNPs PDCL
Gene Sequence
>906 bp
ATGACCACCCTTGATGATAAGTTGCTGGGGGAGAAACTGCAGTACTACTATAGCAGCAGT
GAGGATGAGGACAGTGACCACGAGGACAAGGACCGAGGCAGATGTGCCCCAGCCAGCAGT
TCTGTGCCTGCAGAGGCTGAGCTGGCAGGCGAAGGCATCTCAGTTAACACAGGCCCAAAA
GGTGTGATCAATGACTGGCGCCGCTTCAAGCAGTTGGAGACAGAGCAGAGGGAGGAGCAG
TGCCGGGAGATGGAAAGGCTGATCAAGAAGCTGTCAATGACTTGCAGGTCCCATCTGGAT
GAAGAGGAGGAGCAACAGAAACAGAAAGACCTCCAGGAGAAGATCAGTGGGAAGATGACT
CTGAAGGAGTTTGCCATAATGAATGAGGACCAAGATGATGAAGAGTTTCTGCAGCAGTAC
CGGAAGCAGCGAATGGAAGAGATGCGGCAGGAGCTTCACAAGGGGCCCCAATTCAAGCAG
GTTTTTGAGATCTCCAGTGGAGAAGGGTTTTTAGACATGATTGATAAAGAACAGAAAAGC
ATTGTCATCATGGTTCATATTTATGAGGATGGCATTCCAGGGACCGAAGCCATGAATGGT
TGCATGATCTGCCTTGCCGCAGAGTACCCAGCTGTCAAGTTCTGCAAGGTGAAGAGCTCA
GTTATTGGCGCCAGCAGCCAGTTCACCAGGAATGCCCTTCCTGCCCTGCTGATCTATAAG
GGGGGTGAATTGATCGGCAATTTTGTTCGTGTTACTGACCAGCTGGGGGATGATTTCTTT
GCTGTGGACCTTGAAGCTTTTCTCCAGGAATTTGGATTACTCCCAGAAAAGGAAGTCTTG
GTGCTGACATCTGTGCGTAACTCTGCCACGTGTCACAGTGAGGATAGCGACCTGGAAATA
GATTGA
Protein Properties
Number of Residues 301
Molecular Weight 34281.3
Theoretical pI 4.37
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosducin-like protein
MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPK
GVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMT
LKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKS
IVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYK
GGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEI
D
GenBank ID Protein 4104075
UniProtKB/Swiss-Prot ID Q13371
UniProtKB/Swiss-Prot Entry Name PHLP_HUMAN
PDB IDs Not Available
GenBank Gene ID AF031463
GeneCard ID PDCL
GenAtlas ID PDCL
HGNC ID HGNC:8770
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  6. Thibault C, Feng Wang J, Charnas R, Mirel D, Barhite S, Miles MF: Cloning and characterization of the rat and human phosducin-like protein genes: structure, expression and chromosomal localization. Biochim Biophys Acta. 1999 Mar 19;1444(3):346-54. [PubMed:10095058 ]
  7. Carter MD, Southwick K, Lukov G, Willardson BM, Thulin CD: Identification of phosphorylation sites on phosducin-like protein by QTOF mass spectrometry. J Biomol Tech. 2004 Dec;15(4):257-64. [PubMed:15585822 ]