You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08505
Secondary Accession Numbers
  • 14217
Name PRKCA-binding protein
Synonyms
  1. Protein interacting with C kinase 1
  2. Protein kinase C-alpha-binding protein
Gene Name PICK1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. May be regulated upon PRKCA activation. May regulate ACCN3-ACCN2 heteromeric cation channel
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cytoplasm
  2. perinuclear region
  3. Cell junction
  4. synapse
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.1
SNPs PICK1
Gene Sequence
>1248 bp
ATGTTTGCAGACTTGGATTATGACATCGAAGAGGATAAACTCGGAATCCCGACTGTGCCT
GGGAAGGTGACCCTGCAGAAGGATGCTCAGAACCTGATCGGGATCAGCATTGGAGGAGGG
GCCCAGTACTGTCCCTGCCTCTATATCGTCCAGGTATTTGACAACACCCCAGCAGCCTTG
GACGGCACAGTGGCAGCTGGCGATGAGATCACCGGTGTCAATGGCAGGTCAATCAAAGGG
AAAACTAAGGTGGAGGTGGCGAAGATGATTCAGGAGGTGAAGGGGGAGGTGACCATCCAC
TACAACAAGCTGCAGGCGGACCCCAAGCAGGGCATGTCCCTGGACATTGTGTTGAAGAAA
GTCAAGCACCGGCTGGTGGAGAACATGAGTTCAGGGACCGCAGATGCTCTGGGCCTGAGC
CGGGCCATCCTGTGCAATGATGGGCTTGTCAAGAGGCTAGAGGAGCTGGAGCGGACCGCT
GAGCTATACAAAGGGATGACGGAACACACCAAGAACCTCCTACGGGCCTTTTATGAGCTG
TCGCAGACTCACCGGGCCTTTGGGGACGTGTTCTCCGTGATCGGGGTGCGGGAGCCCCAG
CCAGCTGCGAGCGAGGCTTTTGTGAAGTTCGCCGATGCCCACCGCAGCATCGAGAAGTTC
GGCATTCGGCTTCTGAAAACCATCAAGCCGATGCTGACGGATCTGAACACGTACCTCAAC
AAAGCCATCCCGGACACTCGCCTCACCATCAAGAAGTACCTGGACGTGAAGTTTGAGTAC
CTGTCGTACTGCCTGAAGGTGAAGGAGATGGATGACGAGGAATACAGCTGCATTGCCCTA
GGCGAGCCCCTTTACCGGGTGAGCACCGGCAACTATGAGTACCGCCTGATCCTGCGCTGC
CGCCAGGAGGCGCGCGCCCGCTTCTCCCAGATGCGCAAGGATGTGCTGGAGAAGATGGAG
CTGCTGGACCAGAAGCACGTCCAGGACATCGTGTTCCAGCTGCAGCGCCTCGTGTCCACC
ATGTCCAAGTACTACAACGACTGCTACGCAGTGCTGCGGGATGCCGACGTCTTCCCCATC
GAGGTAGACCTGGCGCACACCACATTGGCCTATGGCCTCAACCAGGAGGAGTTCACAGAT
GGGGAGGAGGAGGAGGAGGAGGAAGACACGGCAGCTGGGGAGCCGTCCAGGGATACACGA
GGGGCTGCTGGGCCCTTGGACAAGGGTGGAAGCTGGTGTGACTCCTGA
Protein Properties
Number of Residues 415
Molecular Weight 46599.7
Theoretical pI 4.94
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>PRKCA-binding protein
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS
GenBank ID Protein 6691439
UniProtKB/Swiss-Prot ID Q9NRD5
UniProtKB/Swiss-Prot Entry Name PICK1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB026491
GeneCard ID PICK1
GenAtlas ID PICK1
HGNC ID HGNC:9394
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  5. Collins JE, Goward ME, Cole CG, Smink LJ, Huckle EJ, Knowles S, Bye JM, Beare DM, Dunham I: Reevaluating human gene annotation: a second-generation analysis of chromosome 22. Genome Res. 2003 Jan;13(1):27-36. [PubMed:12529303 ]
  6. Dev KK, Nakanishi S, Henley JM: The PDZ domain of PICK1 differentially accepts protein kinase C-alpha and GluR2 as interacting ligands. J Biol Chem. 2004 Oct 1;279(40):41393-7. Epub 2004 Jul 9. [PubMed:15247289 ]
  7. Torres GE, Yao WD, Mohn AR, Quan H, Kim KM, Levey AI, Staudinger J, Caron MG: Functional interaction between monoamine plasma membrane transporters and the synaptic PDZ domain-containing protein PICK1. Neuron. 2001 Apr;30(1):121-34. [PubMed:11343649 ]
  8. Takeya R, Takeshige K, Sumimoto H: Interaction of the PDZ domain of human PICK1 with class I ADP-ribosylation factors. Biochem Biophys Res Commun. 2000 Jan 7;267(1):149-55. [PubMed:10623590 ]
  9. Lin SH, Arai AC, Wang Z, Nothacker HP, Civelli O: The carboxyl terminus of the prolactin-releasing peptide receptor interacts with PDZ domain proteins involved in alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor clustering. Mol Pharmacol. 2001 Nov;60(5):916-23. [PubMed:11641419 ]
  10. Hruska-Hageman AM, Wemmie JA, Price MP, Welsh MJ: Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel). Biochem J. 2002 Feb 1;361(Pt 3):443-50. [PubMed:11802773 ]
  11. Excoffon KJ, Hruska-Hageman A, Klotz M, Traver GL, Zabner J: A role for the PDZ-binding domain of the coxsackie B virus and adenovirus receptor (CAR) in cell adhesion and growth. J Cell Sci. 2004 Sep 1;117(Pt 19):4401-9. Epub 2004 Aug 10. [PubMed:15304526 ]
  12. Elkins JM, Papagrigoriou E, Berridge G, Yang X, Phillips C, Gileadi C, Savitsky P, Doyle DA: Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions. Protein Sci. 2007 Apr;16(4):683-94. [PubMed:17384233 ]